SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_091177567.1.29910 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_091177567.1.29910
Domain Number 1 Region: 145-350
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 5.56e-21
Family alpha-mannosidase 0.028
Further Details:      
 
Domain Number 2 Region: 586-819
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0000000000596
Family alpha-mannosidase, C-terminal domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_091177567.1.29910
Sequence length 1051
Comment hypothetical protein [Friedmanniella flava]; AA=GCF_900110855.1; RF=representative genome; TAX=1036181; STAX=1036181; NAME=Friedmanniella flava; strain=CGMCC 4.6856; AL=Scaffold; RT=Major
Sequence
MTSHALPEPPPVWDSSFASSERFLAPSPVWDASLQRRQLLEHAVDASARVERGVVGLIAE
PLVAADGRGTVQSVRLQPLADGVAQVAAIDTGRTRVELDGTELAVGHERIGGGGVRLLVP
EVSSPTPLRVTAQVGEETITLETVLRPPRHYEVHLVQHSHLDIGYTDRQHVVRAQHLSYL
DDVLRLARETDDLDDDARFRWNEEALFSVTDYLANRPPRARDELLRRVAENRVSLSAMPF
NLHTEICSTDELHELLRPALELKRRYGVEFRTAMQTDVPGHVVGLPDALSQLGVRFLSVA
HNWAGRSYPDGQGQMALPRLFRWRGPEGGEVVVWRTDTPHGLAYMEGPMVGFHESYDVAS
QIFGAYLASLGTKPYPMPVGSIFGWLDGGADVNERPPFGGDVLHLRTHGRWSDNAGPSRA
VSDIVEEWNARWLFPHLRVSTNEAFFDAAMERSGDELPTCTGDWNDWWAHGVGSAVAPVG
LGRKAQNDLAAAQILGAAAHLLAPDEVAEPVVDPDEGYRQLALWDEHTWGASNSWEHEDH
GSSSGEHQWYWKVARAYAAVDESDRALQLSTAALAGHLGRHPDALVSVYAVNPTGAARTD
ELEVFLPAGVVPLTQAVTLVDGRTGDALPHTERPEPAGSRGLGRYLRVRLDWVGAVGFVR
VDVRSAEQGPDAAEDLADPTVLENEHLVARIDLRHGTLASLVDKRTGREVVDAGSAFGFN
HYVYDRYATIGRSNHNSSKFADSGNMALISSREVAGPAAVVSATRDARGEQVVVRPEVGS
ARSLQVTYRLPAGVAHLEITNRLSKDSTWDKESAFFAFPFAHDGAPGVLEESAGGLTGPD
VPQVPGGAEYMRAIRHFVSVQDGEAAAGWATAEVPLVELRTLALPYVPFGSTLRTEEPGT
VFSWVHNNIWDTNFPVQQAFDTDLRYRVAVGTGDAPALASRTAESLVQPLRPVVAERADG
AAPAEGSLLGLSDERVQLVGLRHDADGSVLVRLRSNALDGLTARLRVPEGTKAASAATYL
GEPLEDLEVVDGSVEVTFLGSGVRAVRLTLG
Download sequence
Identical sequences A0A1H9ADK1
WP_091177567.1.29910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]