SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_091369915.1.63551 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_091369915.1.63551
Domain Number 1 Region: 711-1140
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.93e-28
Family alpha-mannosidase, C-terminal domain 0.016
Further Details:      
 
Domain Number 2 Region: 294-456
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.000000000000055
Family alpha-mannosidase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_091369915.1.63551
Sequence length 1170
Comment hypothetical protein [Mucilaginibacter mallensis]; AA=GCF_900105165.1; RF=representative genome; TAX=652787; STAX=652787; NAME=Mucilaginibacter mallensis; strain=MP1X4; AL=Chromosome; RT=Major
Sequence
MKTLNIITISVSLIFVLIGFNGLAQNTKFKIIKDIPANEITLSASSTFGPDQSINHLTDG
SGIHNNIHDNNGNALTMWHTTENPVATIPAKGLPACKAWVRFDFSTQKSFNKLLIWNHNQ
ENLTNRGFRLTKVYGTTNGIDWFELATLELSDAKDLNGKASEIVINEKRPLRAVIIAGIS
NWGGNVYGLSGVKFISELEVNESALPFPTGIECTSTSIYRYCKDGKPGREIMLAFTGNNL
YQPSVIEVMADGRTETTAVPYSIYGLEKTTFTLPSGVGIDKEIQIFVTLKSGGKSIRKSF
VLPKQRQWTVYIYPHAHVDIGYTNTQANVEIIHKRNLVNGMMLAKETANYPDGARYVWNP
EVMWPVERYLKNATPTEREELLDAIRKGYIHLDAGYINDNTSVTADEEFPRFFGDAKRLE
KLTGVPVSTIDQTDVPGMSWGIVPMAVQFGIKYIFAPFNGSDRIGLADKFSFKPFWWIGQ
DGVSKVLFLQPGDYTPGAREKGFKYWPLMAGQKDPNKLLQIVKTDHPRENFIDGYLWGKL
KQLEDDSAYSYDIFPMTWAMADNTPIDADLPDAVKSWNEEYAFPHLVIASSTDIMSAFEK
KYGDIIPSFRGDFTEYWTDGLGSAAKETSMNRKSKERLIQTDILWSMLHPWEKAPRAEMD
EAWRNVLMGSEHTWCYMNPYQADMQDEIWGVKQNFFKTAEKSSIQLLANTLNPVSTDKSN
IICVFNTLSWVRSGLVTLSSNQSEGALSVWDDNHKLVNSQRLSTGELVFLAVDVPALGTK
NYTLSTESGEKHDVKMAKGNTLDNGLVKVLIDPITGDITSLKDKKGVEFVNTGAACNLNS
FRYLLGNGKPASSGPQYAANTTASISILSQKPVNATGPIEVQTVIKENGPLLASIQVNSK
ADGCNKLIREVRVIADMPEIEIDNLVDKIATTEKEGIHFGFSFNIPDGRTRIDVPWSVVE
IDADQLPAANRNWICFQRWLDISNEDKGITWCSLDAPTFESGNMTANIIGGAFHSPEWIQ
HLPLSSTIYSWALNNHWHTNFPLSQGGKLNFRYRILPHQYGYDAVKANRFGLEQSQPLIA
TPVKEKIIIHTLVKIDNANVFISIIKTAADGKSMIIRLRSLSEKPEMVNLSFPSFTPKSI
RTCIADETPGKEVGNTINMLPHGITSLIIE
Download sequence
Identical sequences A0A1H1RHP2
WP_091369915.1.63551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]