SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_091482933.1.77840 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_091482933.1.77840
Domain Number 1 Region: 528-988
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.09e-33
Family alpha-mannosidase, C-terminal domain 0.019
Further Details:      
 
Domain Number 2 Region: 107-311
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.82e-22
Family alpha-mannosidase 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_091482933.1.77840
Sequence length 991
Comment hypothetical protein [Gracilibacillus orientalis]; AA=GCF_900114645.1; RF=representative genome; TAX=334253; STAX=334253; NAME=Gracilibacillus orientalis; strain=CGMCC 1.4250; AL=Scaffold; RT=Major
Sequence
MEEYILTNNAKIKDSQNSAKVISFSAENTVFFVRKESELKQVVLVNIELEERISGAELVL
TSKHDKIVEYVGQIGAGRSTLEMYVPEVSEPTSYRVVLRWNSNEMGDTVTVLPEKHWTVH
VVQHSHLDVGYTDPQYEVLEHHLLYLDQVLELCDIDEKNMDTNFKWVIEVTWPLKYWLKS
RPKGQIEKMLQRIKEGRIEVAGAYMSMHTEAYHIDELARTFETTQQLRDEYGIEIDTVLQ
TDVPGHTKGFLKCLTQMDIKYLSVAHNYAGRSIPHLLPGEKLQRPFYWLQENGQKVLVWY
TDTPHGIYMEGNRLGIADSYEETFRKLPELFEQLAEEDYTLDTLHLRVQGSHWDNAGPSI
IPSEVAKQWNEKWAYPKIVTSTNKQFFESVEAKENLDIPTFKGDWSDWWADGIGQGAYPN
GINRKSHHLLRFAEAFHSIAAMHDNTYDYPQQELQSAFDNMVLFDEHTWGAWNPWDKSLS
NNTSGQIQWSTKKGFALNAYNQSLTEYRRSKHLLLNLLDCEHVENMSSIVVYNPESFERT
DIVTVFIPFGKIDVRKPFHVVDNMSGEEITFSINLRMESTPKPRGAFIKFVAENTPSFGY
KTYHVLETTNEDVYHSDVIDNESNILENGFYKIIFDQETGGITNIIDKEINQEIVNSKSP
FQLNQYVYDSYTTAPRFNHLSSRTTGDSNTLGKRSTAHLAKVEQSESNAVFQKMKITLHA
PGCEWIEQEVTLYRNLKRIDIVNRLMKAETESKEAVYIPFPFNVEGGKLRYETTGDYVSP
EDPHVPGSCHYMKAIQHWLSVSNPEYTVLWGTMEAPLIQLENIHIPYAPFETTLPVNEAQ
TIYSYALHNIWDTNFPNKQGGEIEFHYSISSHSGDFDPIEAYKFGSKVQHPLSSVTVPYN
IENSGDSFVTSDKDNIQILAIRKTGSNLFNVRLQEIAGVDTTVTLNFKDVAIKNAYTSNI
ANGDLQKTKSKDNSITVKVNKNDIQTVLINI
Download sequence
Identical sequences WP_091482933.1.77840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]