SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_091979906.1.13075 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_091979906.1.13075
Domain Number 1 Region: 1039-1216
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.03e-25
Family Quinoprotein alcohol dehydrogenase-like 0.0022
Further Details:      
 
Domain Number 2 Region: 840-1076
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.16e-22
Family Quinoprotein alcohol dehydrogenase-like 0.01
Further Details:      
 
Domain Number 3 Region: 780-872
Classification Level Classification E-value
Superfamily PKD domain 0.00000155
Family PKD domain 0.02
Further Details:      
 
Domain Number 4 Region: 686-777
Classification Level Classification E-value
Superfamily PKD domain 0.00000608
Family PKD domain 0.013
Further Details:      
 
Domain Number 5 Region: 497-589
Classification Level Classification E-value
Superfamily PKD domain 0.0000137
Family PKD domain 0.016
Further Details:      
 
Domain Number 6 Region: 592-684
Classification Level Classification E-value
Superfamily PKD domain 0.0000216
Family PKD domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_091979906.1.13075
Sequence length 1227
Comment hypothetical protein [Pseudoalteromonas denitrificans]; AA=GCF_900112265.1; RF=representative genome; TAX=1123010; STAX=43656; NAME=Pseudoalteromonas denitrificans DSM 6059; strain=DSM 6059; AL=Scaffold; RT=Major
Sequence
MNTKLLPFLDTYFKKCLLIILSLCLISCGNSEESATNSALLASQYTINGTAAKGALINAS
VNVYEMDQTGMVINSEPTFQTTTNGSGQFLITLNSFEQPLLIKTSGGKYIDESDQEPDIN
LKRVINFTQEQGLSSVINPGDSTAAVTILTSALLQKSLNETHGNAFFATLNNNRDNAQQV
FGFDIFSTQPADTISPDEASSEQAKQYALLLGGFANIVNRSGLELGFSVPNFDIVDAIIT
DFSDGMLDGKLNNNFISKQNSNDITTNIPSNINLNDEINRFKNNNFTSFSQTSLIEIDEN
TLSQDHADNKMPSIDAGIDIIVKESEAIQIKATASDSDGSIVLIQWEQISGPELILSDSL
EFSMTAPEVTQTTSAVLQVTVTDNRGAINQDQINITIEDVAINQNPTANAGQDQQVNEAQ
VISLSGQASDSDGTIVGFNWQQTSGPNVSILDNDKATASFTAPNVLSITELIFNFTVTDN
SGGQASDQVSIFVSPVNQPPNVNAGADQSVSENTQVTITGSALDTDGSITTLIWTQTFGP
NVVINNANTLTMNFTAPSVSQATTFTFSLSATDNENATSSDSINIIVNPQGNLAPTANAG
IDQAVDSGTSVNLTGSGSDSDGTIISYLWLQTSGTSVSLINANTANAHFVAPNVSSTEIL
VFSLTVTDNSAATGVDTVSITINPINQAPTANAGIDQTVDSAATVDLIGTGSDTDGTIIS
YLWTQTSGTAVSLNNANTANASFTAPTVTSTEILIFSLTVTDNNDAVGIDSISITVQSAN
QAPTVNAGIDQNVTSNSNITLSGSASDSDGSIISHLWKQTAGTSVSLNNATSLSATFTAP
ILSTTEVLTFSLTVTDNLDATASDLINVTVTPLQSGTLLWSFQTSGPVLSSPALDVSGNI
LIGSDDLNLYSISPTGIKNWNFTATGFVRSSPMYTNTGNIYVGSSDNKLYAIDSSGNLIW
NFPTANAIISSPTLLPSGNIFISSVNIIHSVTTQGSEAWQFTIPTGETSSGAISKAGTLF
LGSGDNFIYGFDQPAVHPPKWEFQIGTPVHGAPAIGSDGAIFIGADDNKVYAFELNSDGT
NTLIQRWVFTTSAKVKATPALGANNVLYVGSEDNNFYAIDMTTGSSVWSFPTLASVVSSA
AIASDGTIIFGSGDGNVYALNPDGTLKWKFQTGALISSSPVISPNGTVFIGSADGKVYAI
FDNNGGLSTTAPWPMFRFNSTHTGNIN
Download sequence
Identical sequences A0A1I1FKG5
WP_091979906.1.13075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]