SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_091987095.1.13075 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_091987095.1.13075
Domain Number 1 Region: 101-413
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.13e-61
Family Carboxypeptidase T 0.031
Further Details:      
 
Domain Number 2 Region: 615-689
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000000288
Family PKD domain 0.0018
Further Details:      
 
Domain Number 3 Region: 555-607
Classification Level Classification E-value
Superfamily PKD domain 0.000000131
Family PKD domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_091987095.1.13075
Sequence length 724
Comment hypothetical protein [Pseudoalteromonas denitrificans]; AA=GCF_900112265.1; RF=representative genome; TAX=1123010; STAX=43656; NAME=Pseudoalteromonas denitrificans DSM 6059; strain=DSM 6059; AL=Scaffold; RT=Major
Sequence
MEISMTLINALTFAASLTLSSSSPSVYLAEFSDQKQKIKTKISFHHALLASEDDGLLLEL
TNKEVRLLEKKGITLTAADKKWQKKLSTIQRRSSANQMGGIPGFNCYETVEETFTEADKL
VIQNPNLAQWIDIGDSWQKINGDKGYDLKVLKIGKQSLIDPPILFIQSAMHAREYTTAAL
TLDFAKNLLQNYDSDPDINWILNRHQIHILFQTNPDGRKIAETGVFQRKNVNINHCSQGH
TGIDLNRNFSFGWNTVDGGSSGNDCDETYRGTHPASEPEVSAIEAYVRSIYPDVRGESDT
DAAPIDTKGLYLDIHSYSELILWPFGHTETLAPNNKGLQALGRKLAYFNGYDPGQSVGLY
PTDGTSDNLAYGELGIAHITFELGTAFFQSCNIYNNKIKPDNLKALLYAAKAVEAPYLIT
SGPDIASIEITDADDIYITIDVLATDEQFSTKGGIEAKQNINKVWYSIGAYPNEENSLQA
EIKDGAADTSKEVFTARIKRDDLVNDQITVYFKGEDSSNSQGPVSAKTLTLSQPIANADI
NCQGAKCHLLGKEIANSYLWQLEDGRTSINKATDFIFPSLGSYQATYTVTNSIGLHTTQN
YDFTVTELLKPDIKFSAICSNITCKFDASDTIDLDSDNLIYKWDFGDSTYSDTMVTSHDY
ASTGNFTVTLTVTDEHNQTSVLTQEIITTQVVTQEPTLEKTQSSGGSFIYNLLILIVFLR
VKHK
Download sequence
Identical sequences WP_091987095.1.13075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]