SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_092018164.1.3857 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_092018164.1.3857
Domain Number 1 Region: 74-330
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 3.19e-16
Family 4-alpha-glucanotransferase, N-terminal domain 0.073
Further Details:      
 
Domain Number 2 Region: 471-734,794-892
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00000000000000392
Family alpha-mannosidase, C-terminal domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_092018164.1.3857
Sequence length 914
Comment hypothetical protein [Pseudarcicella hirudinis]; AA=GCF_900115665.1; RF=representative genome; TAX=1079859; STAX=1079859; NAME=Pseudarcicella hirudinis; strain=E92,LMG 26720,CCM 7988; AL=Scaffold; RT=Major
Sequence
MQKTKQIKLAVACLATLNAKRVTIFPYIFLALLLTGPFRISAQEISGNTPVSPIPVPPPV
SNLLPGKKAPIVSDIWVVFKTHCDLGYTMSADAVFKKYRVDMMDNATRLFEADRKKPVKE
RFKWTIAGWPMKADILGPLQTPERKQKVEQALREGAINVHGLPATLESDVMEQEDYVRSL
IFSSQIAREYGHKLPIAAKMTDVPAHSWLLPTLLHNAGIKFIQIGCNYTVQAMRLPQLFW
WEGPDGSKVLCNYTPHYGSGVEPPKNWPSKNYLAVIMTHDNEGPPSSKEIEAVKKQVATM
KGVRLHLADLEEYAKVLLQENPEVPTIRGDMVDPWIHGVMAMPQESKTARNVRPLEPALE
IFNTQLKNWGIKTPSLAEPLAKAYENSMLFSEHTFGAWAPGTGFFSTDGKTEVPVEKRYK
YNDEFVKARKEGFYRKFEASFKDKAHYINITDSLVTNNFAESMKLLSDHVKTRPGNIIVY
NPLPWMRSGIVEIDGEKILAENIPANGYKTFAKPKTTDVAIDDTDKSATTLNTTFYSVKF
DTKKGGITSLIEKSTGKELVDQHSNYALGEFLHERFSYDQTKDYHDRNYTVNNPLAGLKP
NMPKDIAYLATTFSDWTMKTTRTSVSTEVTLTTIHAKPVAQSVSISFTFPNAFAYVDVEW
KVENKIPNTVPDGGWLCFPFNVNNPKYILGRLGGTIDLAKDQIVGGNRYLYAVQSGASVV
SPDQSGVGLCAIDAPLLSFGEPGLWKYDYDYFPKQPTVFVNLYNNMWNTNFPYWTEGTWT
ERVRIWNIQPGIKTSENLAIQSWEARVPLMTITSSSGEGAKLPVQQAGIAVSPKGVLVTA
FGKDPDGNKGTLLRIWEQAGNKGIVDVTLPAGKIYRKATPVNLRGEISGRSVNIVKGKFS
CSIKAFGPASFILE
Download sequence
Identical sequences A0A1I5VK56
WP_092018164.1.3857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]