SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_092032125.1.8005 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_092032125.1.8005
Domain Number 1 Region: 516-796
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.73e-24
Family alpha-mannosidase, C-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 117-319
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.59e-24
Family alpha-mannosidase 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_092032125.1.8005
Sequence length 972
Comment hypothetical protein [Porphyromonadaceae bacterium KHP3R9]; AA=GCF_900116745.1; RF=na; TAX=1855398; STAX=1855398; NAME=Porphyromonadaceae bacterium KHP3R9; strain=KHP3R9; AL=Contig; RT=Major
Sequence
MQSILRYFKKADYTIWLICTLLSITMSAGLRAQEIGTEQVRFMNTPLLFSKNGQKYQQLL
AEYLSDKSGKITFRSGGKELLSSAVTRGENRFLLTLPAVSSPEEITLQTTIDNGEPLYHK
VMVVPPKRWTVYLVQHSHTDIGYTRPQSEILAEQMRYIDYALDYCDQTDNMPDDARFRWS
CESSWVTREYIRTRPASQLDRLFQRIRERRIEVTGMFANMSEIVGEHTLVDLLQPLKEIR
DLGIQVTTAMQNDVNGVAWSMPDLFRNSGVKYLIMGINETRSIRPFEIPTCFWWEAPSGA
RLLAFRGEHYMTGNFYNIGNEEMDFIPLIRGISELEGKGYPFDRIGLQFSGYFTDNAPPS
TAACAFVKEWNATYESPRLRLAVASEFMEYVEKNHAGELPVYRKAWLDWWTDGFGSVSRE
TAEIRKTENAIEQDEGVFSVISMLDGDLPTEMEKKIGHVKENIIFFAEHTVGAAESIESP
FSENSVKQWLQKGAYAWEAVKKETLLREEALARLQPFLFKADFPVINVINPLGWDRSGTV
RVFIDSGIVPSDKRVRITDIATGKEVPFQLIAKRTEGAYWMLEVSDVPALGCKALRIDRA
NEPLLPDTVADDAVLENRYYRLEIDKRSGAVNSLIDKKLNLELVDSNNPYQLGQPVRESS
EKRDTPPFHRTVSHNVRIEKGVKGAIWESIKIFYGMPGFGGAGEGAEKGIELEVRLYRNT
RKIEFAYRAHKEIVTDPEALYIAFPFSLPDSRIVFETTGGTLTWGEQLPGSSSDWNVAQN
FVSVRGSKGQIVLVSNEVPLWHFSDFNMGKFERFPQPGEPWLYSWVMNNYWFTNFRAYQE
GSFSWSYQLTSTDDTTNAFAVRFARGERNSFATRTLPAGMQASGEALLRTLNINGPANAP
LIHIRPSFRKRSVVLHFREVDGLPAEIQLSPANATVTIRKVTEINSLGEETGAAGSTIRL
VPYEVKFIEVEI
Download sequence
Identical sequences A0A1I7FQV7
WP_092032125.1.8005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]