SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_092622989.1.35609 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_092622989.1.35609
Domain Number 1 Region: 281-550
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.04e-16
Family alpha-mannosidase 0.032
Further Details:      
 
Domain Number 2 Region: 670-1107
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0000000000314
Family alpha-mannosidase, C-terminal domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_092622989.1.35609
Sequence length 1137
Comment hypothetical protein [Jiangella sp. DSM 45060]; AA=GCF_900105175.1; RF=na; TAX=1798224; STAX=1798224; NAME=Jiangella sp. DSM 45060; strain=DSM 45060; AL=Chromosome; RT=Major
Sequence
MATEAFADDVVWSIAGTFARGWYSPERAEPVFVVGGSDPAVDWPQTQPGPLDAGHGFRPA
AATIVFEGAADAAAHWHELRLEGVASNGPCPDLTIGIGGRSGLVVLTPQRLDRTWAPTLQ
QPIAGRFERTVTLPPGTVRPGHNELVLTTTADELAPDERREPRQPLFSGLFGSALTWSGL
TLRRLHGETAAAATLTPSPLYVTRDGRLHELVDVLISNAAGLAADVDVTIGDHAETLAVE
PVPFGDVRWRVAVPAFDEPVAGRIVVRDDASPIGWAGQVTPCRRWTLHLIPHVHLDVGYT
DNQAKVIELHNRNIERALAAADETQGYAFSVDGSFVLRNYLQSRDGKRAEQALNAVRDGR
LGLNAFYWLFLSGVASLEECYRAAYFAAGLRRDHGLPITYANLTDVPSYPTAMPSIVAAL
GLDTFFGIANHTRGGSDDGDALQLLSPVRWEGPDGASVLAYFADSYTQLRFICADPPTVA
GGADGLTRFVAPYDRPDYLPDHLPIVGTHVDNEDLADGYADFVQRWNDTYTYPRLRFSTI
ADYADAVRPLLDRLPTLRGDGGSYWEDGVGTQARAAATHRRTQALLPAAETLTSLVATVY
EGLAADVSLLDTAWDRLLLGSEHTWTSAHATERPHSHHAHDQLAWKVGQINDGLRLATDI
ARQALSRLAEKSTTGREGVIVFNALPWTRDAEVEIELEDGIRLETASGEVVPADPGPLVD
GYRVTRLRVSDLPPLGYRAFVPRHDGAAPLPEDEPVGPSFETAHYRVELDPESGRLRRLV
HRATGRALADAGSDYALGEVIYVSGGGTEEGRGLGAEQTSLWGAGLPAPELTVTPADLRL
VGIRRTAWGWVVETEGTAPSIPALRCRWHFPDADDRVEYTVDLTKQPVLAKESVYVAFPF
ALDQAAVRYDRQQGWVDPARDHQPGACNEWFTVAQAVTLTDAGGSIGWTSADAPLFALGD
VVRGRWSSQPPASTGLLLSWVMNNYWFTNTPASQDGDLTLRYAFRPFPDFDPAGATRLGR
ELRTPALAGEVTSLDKGDANPRPLPAEGSLLRTAMPGHVDATIYAGRVREGVLVRLREVA
GHSASATVWHPSPSPAATALRCNAAEDPMTELPVAADGAVIVPVGPYEVVTVLLAPA
Download sequence
Identical sequences A0A1H2AM61
WP_092622989.1.35609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]