SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_092851187.1.17429 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_092851187.1.17429
Domain Number 1 Region: 745-1201
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 9.1e-42
Family alpha-mannosidase, C-terminal domain 0.024
Further Details:      
 
Domain Number 2 Region: 345-535
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 3.38e-24
Family 4-alpha-glucanotransferase, N-terminal domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_092851187.1.17429
Sequence length 1202
Comment hypothetical protein [Algibacter pectinivorans]; AA=GCF_900112595.1; RF=representative genome; TAX=870482; STAX=870482; NAME=Algibacter pectinivorans; strain=DSM 25730; AL=Scaffold; RT=Major
Sequence
MKIKNQKSILNLICSFGLALITISAAYANDGVLKTPKSSAFHGGTGSVGHIESLNVNYRL
HQICKNDIEGYKEMLSGSEYFLYPSLREDMNVAMISRATTGEKGFEFLTGEVPKNYAKDK
VNFFFLSDIDFNLRESFDIFINDKPLLTFNSNKDGSLSITENPGNGNAEYILVRRDLNGD
GLGAFRLTVPTSSLKKGESAKIKVVGRKKSSNCWFMIFKGTDVVERINKSVTDEAAFSIK
QKDGKLYVDAPAHFAGKSIYVISDGKKSKTKTFTGQGELAKASFSINAPKHTFKIVHNIQ
EIVVAFDEGDGKIMKSEIEGSFLYHHVANFNPNWTASLAKLYKPEFFDTYDDFFDKKYET
GLVSIMNSSHQDIAWVDRPEVCIILRDTLLLAPVLKDAFIRDDYGFDIEDGLMLREYIER
HPGSEEQITTLLQRKLMSVGATYNCPYEDMYDAEDQVRQLYLGKKWVKKTFGGYDSKVYW
NVDVPGKTMQLPQILKKAGVDYMVISRHAKGMFHWASPDGSSVFTYSPGHYGNDLLYLSR
DMNNKMKYGAEQVLYWENSFDEGKIQTPLLSSQDMLPAIDYSDYIDTWNAFDKVKDTEGK
DIDVHLPKMELMTVDEFFPLAEKNATKVDTIMGERPNVWVYIHGPGHHDALTASREASKL
LPAAEKFLSIANKIEPELSPYPFEALDEAWQAKIYPDHGWGGHDGDVTDNLFKESFVKSR
TMGQNLLNDGIELISSKIKKNEKLGKPIVLFNSLSWQRTDPVTTTLKFNKAVTKHITIVS
ADKKEVPSQTSNAKYYDDGSIKSIDVTFIAKDIPSIGYATYYLQNKNSSSKNKKSSATIN
KYNNPFYDITFEKGGITSVFDKELKKELFDSSVFKAGDVFTMESVGNGAGEFGDVQQPTM
KDYDQVSAHNTQWEILENGTVYTKYRLEQQINHAIVRQDVTLYHDLKRIYFNTSLRNWSG
ELYREFRTAFPINMDNPEIAHEVPFGSVRVGKDEIETAGERYTPLCKDVHPRAIIDWISA
TDNDISVTLSSSVAAADWIDPTGKTKAGTPILQNLLLASRTSCHWEGNEYSQGGNHNFHN
VFTSNKAGSIIGQKVAKQENEPIQVVLNTITAAKPYLPEQLSFFSFDSENVIVTTVKKAE
DSEDFITRMYNVKDTNETVNISSYFDIKSQNHTNIIEENPVPVAPALNVGKYSIETFSIE
TK
Download sequence
Identical sequences A0A1I1Q0P8
WP_092851187.1.17429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]