SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_093737704.1.64084 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_093737704.1.64084
Domain Number 1 Region: 124-334
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.11e-19
Family alpha-mannosidase 0.021
Further Details:      
 
Domain Number 2 Region: 561-1000
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.13e-18
Family alpha-mannosidase, C-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_093737704.1.64084
Sequence length 1030
Comment alpha-mannosidase [Streptomyces sp. DvalAA-14]; AA=GCF_900091855.1; RF=na; TAX=1839759; STAX=1839759; NAME=Streptomyces sp. DvalAA-14; strain=DvalAA-14; AL=Contig; RT=Major
Sequence
MSDRHTRPSWWDSSIARDALRERAVTHEHRHGATTVRLSLEPLLRRTPSGGLTQSVRVDI
EPAPARPVGSAVLRIAGGGPVDCEVIDGPAGSVRVLVPAVEREVAAVLELPGLALPEPLP
VLLRPQRRWTVHLVQHAHLDIGYTDPQGTVLAEARSALDTCLELIRATDDWPEAARYRWS
VEGLSTFTDWTAHRPPSQVAEFVRRIREGRIELTALPFNLHTETCSVDELHELLRDAVAV
RERYGVPLTTAMQTDVPGQVVGLQDVLAEHGVRQLSVAHNWAGRAAPHLVGGARLPRLFR
WRTADGGSVLVWRTDTPHGLAYMEGSIIGFDESHAAVDDLFPAYLTALAEHPVPHQGKGI
PGYPILDAAYEADPYPWDILHLRVLGTFADNGPPRLVAAETVRRWNETWAHPRLRLSRHE
DFFTDAEARLGDRLETFEGDWSDWWVDGVGAGAAPLAMNRTAQSALADAQTLDTLAALRG
AEGEPAPAGETGRTYRAVSLFNEHTWGAGDPWTYGCRGHGSGEQQWHWKYGQAVQAHDGA
LALLERAAHRLGTALPQAPGARASFHVVNTRSRTRTDVVRFFLPESVLPLGIPAAVVDGR
TGRELPVAGEPQTNPLHRSAGRFLHVTVADVPPLGTVRLDVVAADTAHEPVSGESVVLEN
EFLSVRVDLRGNRVASIVDKTTGTELVDSQAVFGFNGYVYDRYATAGGFNHQSSKTVADD
SLHLLAGREVAPAAVLVERTSSAVAETLVYECVPPGAAKLRTTLTLAHGVARLDIANHLV
KPATMTKESAFFAFPFALPDPVVRMEASGGAVGTDLPLIPGSARHMRAIRRWATLTGGGT
AVGWATHDAPLVQHGNIAVPYVPYPPSVPGQEPGTLYSWVHNNIWDTNFPSRQAFEQTFR
YSVAVRRDGDPTAPAELGMRAAEPGHPLHAVRARGVSGGAAETSLIAVDRPDVRVVGLLS
RPAGEFLIRLQSFADEPVAAGLRLDLPYTAALRCSYLGENAVPVAPAPDGTLRVELAARG
TAALLVRTPD
Download sequence
Identical sequences A0A1C4PDB1
WP_093737704.1.64084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]