SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_093919326.1.60960 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_093919326.1.60960
Domain Number 1 Region: 499-953
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.29e-46
Family alpha-mannosidase, C-terminal domain 0.0097
Further Details:      
 
Domain Number 2 Region: 115-379
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.18e-34
Family alpha-mannosidase 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_093919326.1.60960
Sequence length 954
Comment hypothetical protein [Sunxiuqinia elliptica]; AA=GCF_900113005.1; RF=representative genome; TAX=655355; STAX=655355; NAME=Sunxiuqinia elliptica; strain=CGMCC 1.9156; AL=Scaffold; RT=Major
Sequence
MKTIFLKTFMVLLVAVNASPLIAQNKTVVFNYHKPYQTKYVDGVLLAKASVESASVKGYD
QLIFDRGYRTGFTQQHDTTWLWLPVIGQPEKIQFTSASQKMSHQQLFTPLVSDDWGYFKN
GRIHVICSSHQDIAWMNTPDSCRHERVHDIVLPALDLIDEHPEFKFEMEQSLNLMEAIED
APNERQRIIKSYQSGNFEWGATFTQPYEGLESDEQLVRQTYLGRKWIKDNLPGMDAKVAY
NIDVPGRSLQVPQILSKAGIDYLFVSRMKEGFYNWHSPDGSKILTYSPGNYGWSLLIYKY
LEEDAITALQKLNQVLKNWNDYYQEHHLPPHYALVISTDAGGPKYYEEVIREWNEIASKS
KAGIPQIQHSTADEFLNEINTPEARFDSISGERPNLWVYIHGAAHYEAIKAKKQAAVNVP
AAETFSTINSLLENSFEEYPQKELFEAWYKSIYPDHGWGGKNGAITDSIFQASLEQGNEI
GQKILRMALENISDKVSLPNKYNVIVYNDLSWPRNGTAKVDISGLKGDNWVLVAPDGERV
PAQIVENQELVFQVKNVPSIGYKTYQLKKESQKAGNFEVASNYCENNFYKITFGNGGITS
LYDKQLEKEMINSTRFAAGDLLYMGYDGHGAGEFVQVTEPNLTDFEELHQKNAQWEQVVN
GDIFSVFQASYQMADFKVIQKITVYHQKKQIDFEYDIPDWNGRHNRQIRAAFPLNMKEDA
QVSYDVPMGMIHVGKDEMTQRPKGWAWGGTYWQKPAEIRPREIQNFMTASDSQAGVTIST
NVVTADWVDPTREKADYTILNFVLLSTHKSCHGLGNWYHQTGAHEFKFSLSSHEPGWKNG
YHFGVEENHPFHVVQREGKQQGALPIEKGFVTTSDALTKITALKKAENDDNVVLRILEVE
RQNKEVSVTTNWNAEAVYQTNLIEEAPNLVPHTANEFKVKLEGSAIETYKLELK
Download sequence
Identical sequences WP_093919326.1.60960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]