SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_094766631.1.51982 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_094766631.1.51982
Domain Number 1 Region: 755-1190
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.92e-42
Family alpha-mannosidase, C-terminal domain 0.014
Further Details:      
 
Domain Number 2 Region: 351-545
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 7.78e-27
Family 4-alpha-glucanotransferase, N-terminal domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_094766631.1.51982
Sequence length 1212
Comment hypothetical protein [Pseudozobellia thermophila]; AA=GCF_900141855.1; RF=na; TAX=192903; STAX=192903; NAME=Pseudozobellia thermophila; strain=DSM 19858; AL=Scaffold; RT=Major
Sequence
MFREAIVYNRKCGVRIWTCMSLFFVLNQAGASHFFGNEGGTSKRAEFAKPMHEGNGNGHI
QELNTNYRLYELAKNDVEGYKKMLSGSEFFLYPSLREDVNVSMIARATTGQMGFEFLTGE
VPLDHSSDTVTFFMLSDIDLNLNEPFDIYVNDRLLLTFHTNEDGSLTIVENPGKGNAQYI
LIRRDGNGDGIGAFRLTVPSSFVEKGKSSKVRFNGRKKNSNCWVMIFKADDALARLKESV
KSEAAFVIKENNGVLFVDAPAYFNGKKVYVVSDGKRSKVKSLKAQGDLSKTSFDTPSPKK
SFALVYDGVEMALSFEKGDGTISTTDIVGNYLLHHETYNRGSGWFASLSKLYKPEFNETF
DDFFDRKYENGLVSIMNSSHQDIAWVDRPEVCIILRDTLLLAPVLKDAFIRDDYGFDIED
GLMLREYLERHPESREQLTTLLKRNLISVGATYNCPYEDMYDAEDQVRQLYLGKKWVKKN
FGGYDSKVYWNVDVPGKSLQTPQILKKAGVDYMVISRHAKGMFHWASPDGSSVFTYSPGH
YGNDLLYLSRDMNNKLKYAADQTLYWEDTFKGGEIQTPLLSSQDMLPAIDYSGLIDTWNS
FDDLKYEGGAKKKLFLPKMELKTMDEFMPLAEKNAINVDTIMGERPNVWVYIHGPGHHDA
LTASREASKLLPAAEKFLSIAHTLDPKMMKYPFEALDEAWQAKIYPDHGWGGHDGDITDN
LFKENLVKARNMGQDLLNQGLGFISRRVKKKEKLGIPVLLFNSLSWKRTDPVTTKVDFEK
GQVSRVGIMGSDKNPVTVQTSSESYYNDGSLKSAEITFIAEDIPPIGYATYYVFDDKKDT
CKKEAPKTSASSYENPYYKVSFAKGGIAQVYDKDFKRDLFLPGHFKVGEVFTMQSIGNGA
GEFGDVQQPSMVDFDQVSAHDPEWKILEDGPVYTKYRLEQPILHTIVRQDVTLYHKLKRI
YFDTSLRNWSGELYREFRTAFPVKMENPEIAHEVPFGSVRVGKDEIKTAGERYTPLCKDV
HPRAIIDWISATDDEVAITLSSSVSAADWINPTAPDSDKSVLQHLLLASRTSCHWEGNEY
SQAGNHDFHSVLTSNGAASVMGQKIAKQKNEPLQVVVYPDTSTNAFLPETASFYAIDSDN
VIITTLKKAEDTDEIIARMYNLTGKEETVNVSSYFNIKAYKKTNIIEEFPQLVPPQLKIG
KYAIETFSLNLD
Download sequence
Identical sequences A0A1M6GFF6
WP_094766631.1.51982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]