SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001015481.2.55412 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001015481.2.55412
Domain Number 1 Region: 637-903
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000414
Family Tropomyosin 0.0021
Further Details:      
 
Domain Number 2 Region: 373-628
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000111
Family Tropomyosin 0.0014
Further Details:      
 
Weak hits

Sequence:  XP_001015481.2.55412
Domain Number - Region: 881-1080
Classification Level Classification E-value
Superfamily Tropomyosin 0.0915
Family Tropomyosin 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001015481.2.55412
Sequence length 1143
Comment hypothetical protein TTHERM_00379000 [Tetrahymena thermophila SB210]; AA=GCF_000189635.1; RF=representative genome; TAX=312017; STAX=5911; NAME=Tetrahymena thermophila SB210; strain=SB210; AL=Scaffold; RT=Major
Sequence
MSYQYSQNLVQSTNVPPGSIQYSQNNIQTAGRTLIDSSSPEHPIQLASSNQVVSQILTTT
QGSPTRQSKTFVYRSESPIRSSQYGKHVVNVSHIEKGQAPIYVSQSTVQNPIYVEKIVKV
ESSNTSELNLLRQRISALELQNKTLTEELITLRNNTPQEVEQIVYIENNEEINKLRYELN
NIKALSDAENENVKRSKKNLEDQFNSVLQERDRMIIQLKELTVKITEFQSLIASRDIQIN
NLKIQNENLATRLVLTTAELEKITQVKVEAEPLRRKVTELEQYLIQQEKIIEDLRNRLGQ
QDQVISQLRMFEIRCSQYEQEINALRAKLQESENNSLLLIKKIEELQNLLNDENVKRSKK
DGELAISLRDKQALEEKLVHLTQQVEFLTRKVAAQEQDINAQRTRIIELEGIAAKVGSYE
QQIQYLSQQIERLNQVIREKDQTITQLNIELNQLRLSNSQIAQLQEQVVTLQQNLVTRTA
EVESLRKRVSEQELLINQLRMFEQRVGEYEQIINALRQRIAELEAQLNDENVKRSKKDGE
LAISLRDKQALEEKLVHMTQQIEFLSQKVNQLTGQVAERDQIISQLRVYEIRVKEYENVI
NALRQRVAELEAQLNDENVKRSKKDGELAISLRDKQALEEKLVHMTQQIEFLSQKVAQYE
KILGEQQQQLAERDNIINQLRVFEIRVKEYENVINALRQRVAELEAQLNDENVKRSKKDG
ELAISLRDKQALEEKLVHMTQQIEFLSQKVAQYEKILGEQQQQLAERDNIINQLRVYEIR
VKEYENVINALRQRVSELEAQLNDENVKRSKKDGELAISLRDKQALEEKLVHMTQQIEFL
SQKVNQLTGQVAERDNIINQLRVYEIRVKEYENVINALRQRVAELEAQLNDENVKRSKKD
GELAISLRDKQALEEKLVHMTQQIEFLNMKVTSYEKQIQEKDGQINQLRIEISQLQINLQ
QLQNASEEVRRLTELLVVKTTEIDQLRKRLAELEIALQEFNLVQAKLQECEKNNQLLRQR
IAELEALLNDEAVKRSRNQGDLEISLRDKQALEEKLVHMTQQIEFLSRKVTQLTEENSNL
RVIVSSYQQIIDEWQSISVRHASFSQLLENLKVRVQQISFSSSSSSQVISQSSYVRSSGV
AHK
Download sequence
Identical sequences Q23FB7
40.m00239 5911.XP_001015481 XP_001015481.2.55412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]