SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001087355.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001087355.1.72884
Domain Number 1 Region: 644-707
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000715
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 24-78
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000196
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 3 Region: 564-612
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000719
Family TSP-1 type 1 repeat 0.00084
Further Details:      
 
Domain Number 4 Region: 141-173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 699-754
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000809
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 6 Region: 80-128
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000157
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001087355.1.72884
Sequence length 934
Comment PREDICTED: complement component C6 isoform X2 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MARHSILYFILLSALINKGQGCFCDHYPWSQWSSCSKTCNSGTQSRHRQIVVDKYYQENF
CEQICSKQETRECNWQSCPINCLLGDFGPWSDCDPCVEKQSKVRSVLRPSQFGGQPCTEP
LVVFQPCIPSKLCKIEEADCKNKFRCDSGRCIARKLECNGENDCGDNSDERDCGRTKAVC
ARKYNPIPSVQLMGNGFHFLAGEPRGEVLDNSFTGGICKTVKSSRTSNPYRVPANLENVG
FEVETAEDDLKTDFYKDLTSLGHNENQQGSFSSQGGSSFRVPIFYSSKRSENINHNSAFK
QAIQASHKKDSSFIRIHKVMKVLNFTTKAKDLYLSDVFLKALNHLPLEYNSALYTRIFDD
FGTHYFTSGSLGGVYDLLYQFSSEELKNSGLTEEETKHCVRIETKKRVLFVKKTKVEHRC
TTNKLSEKHEGSFLQGAEKSISLIRGGRSEYAAALAWEKGSSGLEEKTFSDWLESVKENP
AVIDFELAPIVDLVRNIPCAVTKRNNLRKAFQEYAAKFDPCQCAPCPNNGRPTLSGTECL
CVCQSGTYGENCERRSPDYKSNAVDGHWGCWSSWSTCDATYKRSRTRECSNPAPERGGKR
CEGEKRQEEDCTFSIMENNGQPCINDDEEMKEVNLPEIEADSGCPQPVPPENGFIRNEKK
LYSVGEDVEISCLTGFETVGYQYFRCLPDGTWRQGDVECQRTECIKPVVQEILTITPFQR
LYRIGESIELTCPKGFFVAGPSRYTCQGNSWTPPISNSLTCEKDSLTKLKGHCQLGQKQS
GSECICMSPEEDCSHYSEDLCVFDTDSNDYFTSPACKFLAEKCLNNQQLHFLHIGSCQDG
RQLEWGLERTRLSSNSTKKESCGYDTCYDWEKCTASTSKCVCLLPPQCFKGGNQLYCVKM
GSSTSEKTLNICEVGAIRCANRKVEILHPGKCLA
Download sequence
Identical sequences F7HG52
ENSMMUP00000027679 9544.ENSMMUP00000027679 XP_001087355.1.72884 XP_014995440.1.72884 ENSMMUP00000027679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]