SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001103842.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001103842.1.72884
Domain Number 1 Region: 6-439
Classification Level Classification E-value
Superfamily ALDH-like 6.02e-125
Family ALDH-like 0.000000000404
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001103842.1.72884
Sequence length 468
Comment PREDICTED: aldehyde dehydrogenase family 3 member B1 isoform X1 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MDPFEDTLRRLREAFHMGRTRSAEFRAAQLRGLGRFLHENKQLLHHALAQDLHKSAFESE
LSEVAISQGEITLALRNLRAWMKDEHVPKNLATQLDSAFIRKEPFGLVLIIAPWNYPLNL
TLVPLVGALAAGNCVVLKPSEISKSMEKVLAEVLPRYLDESCFAVVLGGPQETGQLLEHR
FDYIFFTGSPRVGKIVMTAAAKHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFRYFNA
GQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSPNLGRIINQKQFQRLRALLGC
GHVAIGGQSDESDRYIAPTVLVDVQETEPVMQEEIFGPILPIVNVRSVDEAIEFINRREK
PLALYAFSNSSQVVKRVLTQTSSGGFCGNDGFMHMTLASLPFGGVGASGMGQYHGKFSFD
TFSHHRACLLRRPGMEKLNALRYPPHSPRRLRVLLVAMEARGCSCTLL
Download sequence
Identical sequences A0A1D5QTX0
ENSMMUP00000030523 ENSMMUP00000030523 9544.ENSMMUP00000030523 XP_001103584.2.72884 XP_001103842.1.72884 XP_014968996.1.72884 XP_014968997.1.72884 XP_014968998.1.72884 XP_014968999.1.72884 XP_014969000.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]