SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001114456.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001114456.1.72884
Domain Number 1 Region: 545-590
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000889
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 2 Region: 123-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000114
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 63-112
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000301
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Weak hits

Sequence:  XP_001114456.1.72884
Domain Number - Region: 499-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.067
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001114456.1.72884
Sequence length 591
Comment PREDICTED: complement component C8 beta chain isoform X1 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MKNSRTSAWRALVELFLLCAALGCLSLPGSRGERLHSFESNAVNKSFAKSRQTRNVDVTL
MPIDCELSSWSSWTTCDPCQKKRYRYAYLLRPSQFHGEPCNFSDKEVEDCVTNRPCRTQV
RCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGIN
LFTNSLEGSVLDHRYYAGGCSPHYILNTRFRKPYNVESYTPQTQGKYEFTLKEYESYSDF
EHNVIEKAASSSGFSFGFKIPGIFELGISRQSDRGKHYIRRTKQFSHTKSVFLHARSDLE
VAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVLGGIYEYTLVM
NKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVKLGVSIGKCRGILNEIKDRNKRDTMV
EDLVVMVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKIKVEPLYELVTATDFA
YSSTVKQNMKQALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRK
NIPTDGKWNCWSSWSSCSGGRKTRQRQCNNPPPQNGGSPCSGPASETLDCS
Download sequence
Identical sequences A0A1D5RJJ1
9544.ENSMMUP00000030277 ENSMMUP00000030277 XP_001114456.1.72884 ENSMMUP00000030277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]