SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001166354.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001166354.1.37143
Domain Number 1 Region: 176-333
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 4.97e-67
Family DNA-binding protein LAG-1 (CSL) 0.000000856
Further Details:      
 
Domain Number 2 Region: 30-178
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.98e-66
Family DNA-binding protein LAG-1 (CSL) 0.0000107
Further Details:      
 
Domain Number 3 Region: 334-446
Classification Level Classification E-value
Superfamily E set domains 1.21e-41
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001166354.1.37143
Sequence length 500
Comment PREDICTED: recombining binding protein suppressor of hairless isoform X1 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MDHTEGSPAEEPPAHAPSPGKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSY
GNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGK
NYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLC
IASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDG
YIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCL
SQERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESL
QLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQ
PVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGS
YTNASTNSTSVTSSTATVVS
Download sequence
Identical sequences A0A2I3SR34 Q06330
ENSPTRP00000044315 ENSP00000345206 ENSP00000354528 ENSP00000345206 ENSP00000354528 9598.ENSPTRP00000044315 9606.ENSP00000345206 ENSP00000347659 gi|42560227|ref|NP_005340.2| NP_005340.2.87134 NP_005340.2.92137 XP_001166354.1.37143 XP_016863661.1.92137 ENSPTRP00000044315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]