SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001239651.2.59393 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001239651.2.59393
Domain Number 1 Region: 309-578,626-674
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 2.15e-85
Family IF2B-like 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001239651.2.59393
Sequence length 684
Comment translation initiation factor eif-2b delta subunit [Coccidioides immitis RS]; AA=GCF_000149335.2; RF=representative genome; TAX=246410; STAX=5501; NAME=Coccidioides immitis RS; strain=RS; AL=Scaffold; RT=Major
Sequence
MAPISGTQILWLLSILLIFYFSLPAFLQKKLAFRMTESTKKNGFGRATVALSRRCLRWPR
RKLMGIFRSKKSRPPRAPHMTQYAVQHHRHHATTAEENSNGNIAVDKEILRTDAIMWAPQ
GVVNSGVPQLSGGESSTKKGDRTSAAATSGSPSAAMNGGVEKKKDEEKGVDGKQTTEKKD
KPEGAANAPKLSNAELKKRAKAEKAARRAKEKQEREQQAGPAAQSQAGQQPAGPKKGDNK
QSQKKGEGQKAQKQGAGAAVVAQRRGSVHVPAAEAKKKKKKAENENIVAVFGHLPWHSRR
AGIAGVGKEIHPAVVALGMQLRDYVICGSSARCVATLLALRRVVQAYITPIGTSLSRNLT
TYLSHQINYLTTCRPLAISQGNAIRALKLEITTIDPGDSEDEAKQQIYDYIDNYIREKYT
VASQVIANSAAEKIKDGDVILCYANSSVVQKALLTAHAQGKKFRVFIVDTRPLFEGKNLA
RTLSKAGLEVQYSLINGIAYAIREATKVFLGAHAMTSNGCLFSRVGTALVAMSAKERVGG
IDIPVIVCCETAKFTDRVALDSIVVNEIAEADDLVGIEPSEQVTQLSPPTPAPTRKGGST
KSAGANADTSSLASSLGPTSLVTDHNRPLQNWRDMKHLQLLNIMHDVTPAQYIDMVITEM
GSLPPSAVPIVHRMSTESEDSKHY
Download sequence
Identical sequences J3K1Z8
CIMG_09272T0 XP_001239651.2.59393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]