SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001243229.2.59393 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001243229.2.59393
Domain Number 1 Region: 27-111,211-445
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.26e-74
Family IF2B-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001243229.2.59393
Sequence length 452
Comment translation regulator GCD7 [Coccidioides immitis RS]; AA=GCF_000149335.2; RF=representative genome; TAX=246410; STAX=5501; NAME=Coccidioides immitis RS; strain=RS; AL=Scaffold; RT=Major
Sequence
MAAPAILPMTPSLSSYIQSLKQSSVEASTENLITLLKRRHIRQPHSCALATAHLLLRAMH
TNKSNDPATLIDHVKRIGRRLVSAQPRQLIVGNIVRRVLGMMRDEAESWKRDCGMMSDAG
SDDTRPHTPPHGGFHNLARLPTHPGGALEKLSHLDSLERPSFTGHVTAAPALPGTSMFNL
LSYPPESTDPNSPISVSRGEPDTSDDKPRDYRGEVFDGIKEILEELNQANDQIAAYALDH
IHSNEVILTHTASTTVQKFLLKAAAKRKFSVIQVESYPNNHDDTHATVTGIRSGDEERLT
PEAFQKPLIAQGITVILIPDSAVFALMSQVNKVILGTDCVLANGGLVAAAGTRLIANAAK
AHKTPVVVVSGVYKLSPVYPFDQQSLVEYGDPSAVLPYEDGELVDNIDVVNPLSDYVPAE
LIDLYITNIGGHAPSYLYRIVADHYRNEDVKL
Download sequence
Identical sequences A0A0J6YB68 J3K9P1
XP_001243229.2.59393 CIMG_11906T0 CIRT_03999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]