SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001265118.1.95823 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001265118.1.95823
Domain Number 1 Region: 96-363
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.93e-69
Family D-glucarate dehydratase-like 0.0000812
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.66e-29
Family Enolase N-terminal domain-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001265118.1.95823
Sequence length 383
Comment mandelate racemase/muconate lactonizing enzyme family protein [Aspergillus fischeri NRRL 181]; AA=GCF_000149645.1; RF=representative genome; TAX=331117; STAX=36630; NAME=Aspergillus fischeri NRRL 181; strain=NRRL 181; AL=Scaffold; RT=Major
Sequence
MVKIKSIEYFRVLPRWLFVKIVDEEGQYGWGESTLEGHTEAVEGTLNALCKRFQGYEADD
IEHIWQMAWRLGFYRGGPVFMSAISGIDIALWDLKGRRLGVPVHQLLGGKVRNKLSVYAW
IGGDRPGDVEAAGKARLAQGFKAIKMNATEDINWLDSPSVLDSCVERLKAVKALGLDAAL
DFHGRLHKPMAKQLAKALEPHRPLFLEEPLLSEHPEGIKQLADQVSCPIALGERLYNRWD
VKRFLEDASVDILQPDISHCGGISELRRIASMAETYDVAIAPHCPLGPIALAACMQVDLS
TPNFVIQEMSLGIHYNTEAGEYDITSYVKDPSVFEVKDGYVDALTAPGLGIEVDEEVVRQ
VALKSEPWLCKEFFGPDGGIREW
Download sequence
Identical sequences A1D478
NFIA_019250||mandelate XP_001265118.1.95823 36630.CADNFIAP00001066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]