SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001366710.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001366710.1.35504
Domain Number 1 Region: 31-462
Classification Level Classification E-value
Superfamily Cytochrome P450 9.43e-62
Family Cytochrome P450 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001366710.1.35504
Sequence length 463
Comment PREDICTED: cytochrome P450 20A1 isoform X1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MLDFAIFAVTFLLVLVGAVLYLYPASRQASGIPGITPTEEKDGNLPDIVNSGSLHEFLVN
LHERYGPVVSFWFGRRLVVSLGTMDALRQHINPNRTSHPFETMLKSLLRYQSGLDGDAVE
NHIRKKLYENGVNKSLQSNFAFMVKLSEELLGKWLSYPESQHVPLCQHMLGYAMKAVTQI
AMGNSFEDDQKVIHFQKNHNTVWSEIGKGFLDGSLDKSTTRKKQYEEALMEIETVFKKVI
KERRGRNFSQHIFIDSLLQGNLNEKQILEDSMIFSLAGCVITANLCMWAVYFLTTSEDVQ
KKLHKELDQVLGKGPITQEKIDQLRYCRQVLCETVRTAKLTPIAAKLQDLEGKVDQHIIP
RETLVLYALGVVLQDHCAWPSPYKFDPDRFNDESAMKNLSLLGFSGTQECPELRFAYMVA
TVLLSVLVRKLYLHPLEGQVIETKYELVTSSKEEAWITVSKRN
Download sequence
Identical sequences F7C1X6
ENSMODP00000020324 13616.ENSMODP00000020324 ENSMODP00000020324 XP_001366710.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]