SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001368393.2.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001368393.2.35504
Domain Number 1 Region: 449-579
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000107
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 2 Region: 385-427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000151
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 3 Region: 636-678
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000128
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 4 Region: 671-711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000692
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 5 Region: 738-868
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000957
Family Growth factor receptor domain 0.0081
Further Details:      
 
Domain Number 6 Region: 350-388
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000109
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 307-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000477
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 715-749
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000205
Family EGF-type module 0.034
Further Details:      
 
Weak hits

Sequence:  XP_001368393.2.35504
Domain Number - Region: 600-640
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000117
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 425-454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.073
Family EGF-type module 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001368393.2.35504
Sequence length 1247
Comment PREDICTED: protein jagged-2 isoform X1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MLEPSRRMAATRLGLLFLTIWVQAAQPMGYFELQLSSVKNVNGELQNGDCCDSSRTTRPT
GSGWECGRDECDTYVRVCLKEYQAKVTPTGPCSYGHGATPVLGGNTFSLGVGSNNGRSGH
QDRGSREKGRVIIPFQYAWPRSFTLIVEAWDWDNGTQNDELLIERVSHAGMINPEDRWKS
LHFSGHVAHLEVKIRVQCDENYYSSTCNKFCRPRDDFVGHYTCDQYGNKACMEGWMGPEC
KQAVCKQGCNLLHGGCTVPGECRCQYGWQGRFCDECVPYPGCLHGSCTEPWKCNCETNWG
GLLCDKDLNYCGSHHPCTNGGTCMNTEPDQYQCACPDGYSGKNCEIVEHACVSNPCANGG
SCHEVFSSFECHCPSGWSGPTCAIDIDECASNPCARGGTCIDQVNAFECICPQQWVGTTC
QLDANECEGKPCLNAFSCKNLIGGYYCDCIPGWKGVNCHININDCRGQCQNGGTCKDEVN
GYQCLCSRGFIGKHCELEKNECASNPCQNWGHCEDLVDGFRCHCTRGFSGVFCEVDIDFC
EPYPCQNGARCYSLEGDYYCACPEDYDGKNCSYPKDHCRNGSCKVIDSCEIEVFTNTTRF
ISSNVCGPHGHCVSQPGGNFTCTCESGFTGTYCHENINDCLGMPCQNGGTCIDEIDSFQC
FCPSGWEGELCDTNLNDCFPNPCHNGGHCIDLVNDFYCECRDGWKGKTCHSREYQCDANT
CSNGGTCYDSGDTFQCKCPPEWKGSTCNTAKNSSCLLNPCMNGGTCVGSGDSFSCICKDG
WEGRTCTQNTNDCNPHPCYNGGICVDGVNWFRCNCAPGFAGPDCRINIDECQSSPCAYGA
TCVDEINGYQCICPPGRAGQRCQEVIGFGKSCWSQGMPFPHGSKWTEECNTCHCVDGRTD
CSTVWCGRKPCLLPRHPDYTEDQCPRGQDCLERAYPKCLQPPCVAWGECSPVEPLVPSTP
CQPNSGHLGNNCAKITLIFNRDKVPQGTTVGAICSGIRYLPATRAAAREGLLVLLCDLSA
STENAVEVAISFSPPQDEPDNTLIQNAANTIVNALTKPENSTVLLAVTEVKVETVVMGNS
STDYLVPVLCGVFSIMWLTCIIICVWWTRKRRKERERSRIPREESVNNQWATLNPIRNPI
DKPYSNKDIYYECKNFISPPKRTHDEVEEYVEYEEEEEEEEEEEEEREREVIEVEKFLSQ
KLQKPPLTKGPGDLKESPLGKWAHRGASHKVDNRSLKNVNDYEDGKD
Download sequence
Identical sequences F7D3A1
ENSMODP00000018384 ENSMODP00000018384 XP_001368393.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]