SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001371744.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001371744.1.35504
Domain Number 1 Region: 1117-1169
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.76e-18
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 2 Region: 986-1036
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000139
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 436-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000761
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 690-741
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000588
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 5 Region: 727-776
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000607
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001371744.1.35504
Sequence length 1309
Comment PREDICTED: sal-like protein 1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MSRRKQAKPQHFQSDPVLASLPQRDGDMEKGQTNRTTKNKDAHVCGRCCAEFFELSDLLQ
HKKSCTKNQLVLIVNENPPSPPETFSPSPPSDNPDEQMNDTVNNTDQVDCSDLSEHSKLD
REESMEMQASGTNKSSSGPSSINSSILPSSHSSSMGTSAITTSLPQLGDLTTLGNFSVIN
SNVIIENLQSTKVAVAQFSQEARCNGASSGKLAIPALMEQLLALQQQQIHQLQLIEQIRH
QILLLASQNADMPTSSSPSQGTLRTSANPLSTLSSHLSQQLAAAAGLAQSLASQSASISG
VKQLPPIQLPQSSPGNTIIPSSSGSSPNLNILAAAVTTPSSEKVVSSAGGSQVSNPPVSA
SSPAFAISSLLSPASNPLLPQPAPGNSVFPGPLPNIGTTAEDLNSLSALAQQRKSKPPNV
TAFEAKSTSDEAFFKHKCKFCAKVFGSDSALQIHLRSHTGERPFKCNICGNRFSTKGNLK
VHFQRHKEKYPHIQMNPYPVPEHLDNIPTSTGIPYGMSIPPEKPVTSWLDTKPVLPTLTT
SVGLPLPPTIPSLTPFIKTEEPAPIPISHSAASPPCSVKSDSGVVEIAPRNSSGLPEEAE
GSTLPPSNSKTEEGTPVPNSLTNMNNSVGSPAADSSSGSVATFTNPLIPLMSEQFKAKFP
FGGLLDSAQASETSKLQQLVENIDKKATDPNECIICHRVLSCQSALKMHYRTHTGERPFK
CKICGRAFTTKGNLKTHYSVHRAMPPLRVQHSCPICQKKFTNAVVLQQHIRMHMGGQIPN
TPITENYPESMESDTGSFDEKNFDDLDNFSDENMEDCPDSSVPDTPKSADASQDSLSSSP
LPLEMSSIAALENQMKMINAGLAEQLQASLKSVENGSVEGDVMTNDSSSVGGDMESQSAG
SPAISESTSSMQALSPSNSTHDYHKSPSIEEKQQRALPSEFANGLSPTPVNGGALDLTSG
HADKIIKEDSLGILFPFRDRGKFKNTACDICGKTFACQSALDIHYRSHTKERPFICTVCN
RGFSTKGNLKQHMLTHQMRDLPSQLFEPSSNLGPNQNSAVIPTNSLSSLIKTEVNGFVHG
SSQDSKDTSSSLVPSGPLTSSATSPVLLPALPRRTPKQHYCNTCGKTFSSSSALQIHERT
HTGEKPFACTICGRAFTTKGNLKVHMGTHMWNSTPARRGRRLSVDGPMTFLGGNPVKFPE
MFQKDLAARSGNGDPSSFWNQYAAALSNGLAMKTNEISVIQNGGIPPIPGSLGNGSSSPI
SGLTGSLEKLQNSEPNAPLAGLEKMAGSENGNNFRFTRFVEDNKEIATS
Download sequence
Identical sequences F7BMQ2
ENSMODP00000016412 XP_001371744.1.35504 XP_016283292.1.35504 ENSMODP00000016412 13616.ENSMODP00000016412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]