SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001376294.2.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001376294.2.35504
Domain Number 1 Region: 81-139
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000244
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 2 Region: 129-161
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000299
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 363-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000477
Family Classic zinc finger, C2H2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001376294.2.35504
Sequence length 419
Comment PREDICTED: zinc finger protein Pegasus isoform X1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MGEKKPEPLDFVKDFQEYLTQQTHHVNMISGSVSGDKEAEALQGAGTDGDQNGLDHPSVE
VSLDENSGMLVDGFERTFDGKLKCRYCNYASKGTARLIEHIRIHTGEKPHRCHLCPFASA
YERHLEAHMRSHTGEKPYKCELCSFRCSDRSNLSHHRRRKHKMVPIKGTRSSLSSKKMWG
VLQKKTSNLGYSRRALINLSPPSMVVQKPDYLNDFTHEIPNIQTDTYESMGKTTQTSGLP
RDPQELMVDNPLNQLSTLAGQLSSLPPENQNPASPDVVPCSDEKPFMIQQPTTPAVISAV
STSMPQSSSPTSPEPRPSHSQRNYSPVAGPSSERSAHTSTPSISNSQPSTPTPVLPVQDP
QLLHHCQHCDMYFADNILYTIHMGCHGFENPFQCNICGCKCKNKYDFACHFARGQHNQH
Download sequence
Identical sequences F6ZIR3
ENSMODP00000009690 ENSMODP00000009690 XP_001376294.2.35504 XP_016283171.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]