SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001376525.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001376525.1.35504
Domain Number 1 Region: 144-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000299
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 2 Region: 115-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000407
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001376525.1.35504
Sequence length 295
Comment PREDICTED: epidermal growth factor-like protein 8 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MGSRDRVLLCSLLVGFSVLMLLGGQRLNGDLPFSKGVCSRQTLVVPLRYNESYSQPIYKP
YLTLCAGRRVCSTYRTTYRVAWREVRREVQQIHAICCQGWRKKHPGALTCEEAICAKPCQ
NGGICMQPDQCDCTPGWGGKHCHVDVDECRTGITLCSHSCSNTLGSFICSCPKGLALGSD
GRTCEEIHPEPLPSPSILSLTVREAEKEEHSLRQEIGELRGRLEVLEQWAGHASAWVRAM
LPVSPEAIRPEQVAELWGRGDRIDSLSDQVLLLEEKLGACSCEDNSLGPGLNSRR
Download sequence
Identical sequences F7G6J1
ENSMODP00000018630 XP_001376525.1.35504 XP_007483667.1.35504 ENSMODP00000018630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]