SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001395597.1.80561 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001395597.1.80561
Domain Number 1 Region: 66-102
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000000183
Family Zn2/Cys6 DNA-binding domain 0.0026
Further Details:      
 
Domain Number 2 Region: 4-54
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000168
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001395597.1.80561
Sequence length 389
Comment hypothetical protein ANI_1_1840104 [Aspergillus niger CBS 513.88]; AA=GCF_000002855.3; RF=representative genome; TAX=425011; STAX=5061; NAME=Aspergillus niger CBS 513.88; AL=Scaffold; RT=Major
Sequence
MPPKTYWCQAPGCKASYQRKEHLRRHEAQHTQHQLRQCTACTQKFRRSDTLRRHMQNVHG
VNDMPDSKHACAHCRKQKSRCQGGPPCNKCLRRGIHCSLERRAEPHPADPPDPPRMLQPP
PAQPETDDSDQESHYIGTYFNVFHPRWPFVHQGSFGNHEAPLLVKSMLVLGLWMSKQRKA
QSKAIELHNVLGLAIRQQTDAWDASIADATSNCKWPISTYQAILLHIIFAGLYRGGGELD
LDLKPSLAPADADLLERLVVSCKKLGMFFYPNILEHYSNSILPGFSWVSIEDAKRFNLAL
FRVCRAFGILDKDEGKIMPGTTSGRLRACDLQFPPPKNTPLWNAVTKDEWESAATADMDR
HGIYDPLPQEWISNSADIVELVVTGFPLD
Download sequence
Identical sequences A2QZK8
XP_001395597.1.80561 CADANGAP00009779 5061.CADANGAP00009779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]