SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001538191.1.38663 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001538191.1.38663
Domain Number 1 Region: 4-220
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.28e-67
Family Capz alpha-1 subunit 0.0000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001538191.1.38663
Sequence length 267
Comment conserved hypothetical protein [Histoplasma capsulatum NAm1]; AA=GCF_000149585.1; RF=representative genome; TAX=339724; STAX=5037; NAME=Histoplasma capsulatum NAm1; strain=NAm1; AL=Scaffold; RT=Major
Sequence
MPSNLEIASSFIRGAPPGELSDVVADIKALTPDGPALISSLAPAFEKYNEEQLATVKLPG
GSEEVIVSSYNKLDGNRYYDVQTQTSFQFDHVTQTASSPQSYVLESRHSDLMNGRYRAIY
TVPAPSTDTITGTIHINVHYYEDGNVSLNTTKPISISLPVNSSADTVIKRIAAAERAQQL
ELSDAFSRLSEGAFKGLRRQLPITRQKVEWEKVGGYRLGQDISGGKGRLQAVPAINLSSP
ITKSEMLPGQILRVRSKKRADGHFSTP
Download sequence
Identical sequences A6RA08
XP_001538191.1.38663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]