SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001560743.1.26476 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_001560743.1.26476
Domain Number - Region: 427-475
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00026
Family Ankyrin repeat 0.012
Further Details:      
 
Domain Number - Region: 244-273,327-353
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0407
Family N-acetyl transferase, NAT 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001560743.1.26476
Sequence length 479
Comment hypothetical protein BC1G_00771 [Botrytis cinerea B05.10]; AA=GCF_000143535.1; RF=representative genome; TAX=332648; STAX=40559; NAME=Botrytis cinerea B05.10; strain=B05.10; AL=Scaffold; RT=Major
Sequence
MADSSIEVLRKRKSDSGVDTSTDLPATITGLSVTTTVAKRSKMVIGVNTLISDELIATNE
SEVDVDRIYHQPTVSDVEDPNVGASEELSKDEFDDELGDEYSYEDENIHGAGDSGSREYG
VEGREITIQQDGTDNVAKLRLFLTKDDEFADWLHMIHVNCTVDGKRIGHAFGQYICREEI
REDFWSEMEAPSRELSLVAFKLFDRYGYLNGHLKNHCVQKGTGVWGDELDFGSLFILEHV
EVTERKWRRKGLGRAMVGDLVKKAEVLHKPSPLNTPEDNMFEDMFWFGRNKERERRAKIH
IISMPGYLRHDVEPQYEGKSEPEQHEINSRAIDSAISFHRSLGFRRIGASSYFGLSPDPN
HKSHSLAIQDDFDPPKPPSTPAEEPELVGLEKLRKKLTPLNFAAVSLPDVELLEFYKTFQ
IEDEKEWKQVDHLDNTLLHIAACQFKLQSVQWLMDNVNDKQSLTSARNIDGYTPLEALQ
Download sequence
Identical sequences BC1T_00771 XP_001560743.1.26476 332648.A6RK00

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]