SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001566979.1.15230 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001566979.1.15230
Domain Number 1 Region: 77-174
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.0000000000000354
Family Single-domain sulfurtransferase 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001566979.1.15230
Sequence length 247
Comment conserved hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]; AA=GCF_000002845.2; RF=representative genome; TAX=420245; STAX=5660; NAME=Leishmania braziliensis MHOM/BR/75/M2904; strain=MHOM/BR/75/M2904; AL=Chromosome; RT=Major
Sequence
MKTVRLLLQSDRRTRHHMMIDGEINPREWFNWHPKEYQPWYFDRHKFLYEQGQYAAYHHL
LCHQAYLKDMEHLTRYPEPRTVIIDCRMSPAKMHRWVPHSMWLPRDEVEYALQLTNDEFQ
EMYGFPKPAKDDDVILISHNGLASEQAGWEWRKQYYQHVYNYRGGTNELFGEDYQDFVLK
DRLDPWKGPYPQKSIFVDKWSKRKVLTRTGPFDREYEMQDFALPDLELEKPRHSDDGPRQ
NMPYGLQ
Download sequence
Identical sequences A0A088RXA5 A0A1E1J2E7 A4HIT9
psu|LbrM30_V2.3560 gi|154342055|ref|XP_001566979.1| XP_001566979.1.15230 XP_010701371.1.42505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]