SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001569297.1.15230 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_001569297.1.15230
Domain Number - Region: 297-368
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00707
Family PCI domain (PINT motif) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001569297.1.15230
Sequence length 399
Comment conserved hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]; AA=GCF_000002845.2; RF=representative genome; TAX=420245; STAX=5660; NAME=Leishmania braziliensis MHOM/BR/75/M2904; strain=MHOM/BR/75/M2904; AL=Chromosome; RT=Major
Sequence
MSDVSSTFPWATVDAALAHGDASGAAATALEGLRASPFDRREQFFSQLSLALLPRARAPE
TASCVAEACEALWGMPEFRSNRTSASSVTGEALLLAVVLATAYTTVDKLEKAIAFDAAVL
QSSAFFTYEGLTPLERLACVARVLKASRITADPRHTDSAVQKGMSLYHGIADRARYESGD
DEVQRHRHAVVCTYLLELGLYRQERHDYLRAFQSFFALHENREDAVVLQRSALCALCVRA
SEAERQAALYSVTLRGKDAFLTPSLYHYVQVAYNGQLFSAADVEGVLATAGPYLPQSILR
SALREHNIIILAKTFECVHWRSLCVHMDDEGITEGELYDLLVSMVQAQRVSAAIYQDTGF
IEFTNTAKAHAQITDTDAFNRISAAATAIGKARPELLLV
Download sequence
Identical sequences A4HQH2
XP_001569297.1.15230 psu|LbrM35_V2.6850 gi|154346720|ref|XP_001569297.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]