SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001614418.1.43797 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001614418.1.43797
Domain Number 1 Region: 24-168
Classification Level Classification E-value
Superfamily MIR domain 2.49e-27
Family MIR domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001614418.1.43797
Sequence length 224
Comment hypothetical protein [Plasmodium vivax Sal-1]; AA=GCF_000002415.2; RF=representative genome; TAX=5855; STAX=5855; NAME=Plasmodium vivax; AL=Chromosome; RT=Major
Sequence
MSHYRFFVRVFLFSFLFFKVHSCLHVTDGSSIILENVGTSYKLFSTDMKWGSGSGNQLVT
AIKTNKNEENLLWTVNIYDEVKSFTGNKINCDEIVTLKHVKSNGYLMGSSHDSILSNNYE
LSVHQSKESGKFQVICENKKNSPYWSLGENIYLKSVDHNGYVSASKSYEFNQYNCHNCPI
LYHLEACIMRYTYPRDEQKWRAKSGVIITQFNDERGEKFNGDEL
Download sequence
Identical sequences A0A0J9SFY7 A0A0J9SVU1 A0A0J9TF86 A0A0J9WE55 A0A1G4GW53 A5K7D2
gb|PVX_094755 5855.PVX_094755 XP_001614418.1.43797 gi|156096769|ref|XP_001614418.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]