SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001642532.1.22633 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001642532.1.22633
Domain Number 1 Region: 1-67
Classification Level Classification E-value
Superfamily PR-1-like 5.36e-25
Family PR-1-like 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001642532.1.22633
Sequence length 71
Comment hypothetical protein Kpol_282p1, partial [Vanderwaltozyma polyspora DSM 70294]; AA=GCF_000150035.1; RF=representative genome; TAX=436907; STAX=36033; NAME=Vanderwaltozyma polyspora DSM 70294; strain=DSM 70294; AL=Scaffold; RT=Major
Sequence
AWYDEIANYDYSNPGFSVATGHFTQLIWKDTTQVGCGIKYCGDYYGDYIICSYNPPGNYQ
GEFASEVEPLA
Download sequence
Identical sequences A7TSS7
tr|A7TSS7|A7TSS7_VANPO 436907.A7TSS7 XP_001642532.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]