SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001643624.1.22633 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001643624.1.22633
Domain Number 1 Region: 72-367
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 3.66e-27
Family DeoB catalytic domain-like 0.043
Further Details:      
 
Weak hits

Sequence:  XP_001643624.1.22633
Domain Number - Region: 438-584
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00262
Family Calcium ATPase, transmembrane domain M 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001643624.1.22633
Sequence length 1009
Comment hypothetical protein Kpol_478p1 [Vanderwaltozyma polyspora DSM 70294]; AA=GCF_000150035.1; RF=representative genome; TAX=436907; STAX=36033; NAME=Vanderwaltozyma polyspora DSM 70294; strain=DSM 70294; AL=Scaffold; RT=Major
Sequence
MNGLEDEKFLYKLRFQKFSESHTLYVLFLSLIAILQFISIAFFCKGFLLTRNVLDNVNNL
NPSDLNQDYTKKFDKAVILIIDALRFDFVIPVNSTDPLHNQNYHNNIITLYDQFISQNNN
KDHSSILLKFIADPPTTTLQRLKGLTTGSLPTFIDAGTNFDGSVIEEDNLIKQLYLKNEE
IYFVGDDTWDSLFNPFLSNHSKPFESLNVWDLDTVDNGVISYFNDHLINQKTNDKKWDIL
IGHMLGVDHVGHKYGPNHFTMREKQLQVNNFINDIIESIDDDTLLVIMGDHGMDHTGNHG
GDSKDELESTLFMYSKKTDVWELGDPNNYNIENSGDNYRSVNQIDLVPTLSLLLDVPIPF
NNLGWPINEISKNQNERNIFEQLTLKQLKNYQEVSGLVVNNTEKYFHLEQLYQDSLIDSS
KATIFQNDLLELCKDLWARFDYISITTGIIFLTFSLIILILTTKLIPSIVVSQLVPSFVP
LIFIMILVSNLCIHSLNYVFQYSFFYDDFWWSLFATALGIVIGCFVPILDRYTIKWLIFR
FFGELSDYWSRVGAFFLILHALLFTSNSFTIWEDKIVGYFVISIAILTLYEFTFVPKRQS
TSALLTGVVNEDESEEDANNIQLIKESDSLPLSKGSRLLGVYYSIVLIVCTRLASTITIC
REEQGDYCIPTFTTKNNYSQLTLCVSLVLMLLTPSSIKGYYKLTSSFQGAAPIWISYFLR
FFLLMNAGYWGLTTIENMLENPELDLLFVKLTLARTLLGFSLIALNVGWFMGPLCIDVQI
DQKIDSSENQATIMGYNNIYGSQYFLFILNLFMCIMIFNKPMAQISLYLMLNQILAVIEI
IDLFKLKENIIGPFTLSLISYQQFFSTGHEATIPSVQWDVGFIITDRITFPFTHIGIFLN
TFGPHILVSLSVGLLTLWRQSPAILKPQTLLGRIVSNGGCLLIYNTVLCLSSFVWVTHFR
RHLMVWKIFCPRFLFACLSLISTQLFVTLITIAFASGTLIRQINKLFWA
Download sequence
Identical sequences A7TPM1
XP_001643624.1.22633 436907.A7TPM1 tr|A7TPM1|A7TPM1_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]