SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001643732.1.22633 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001643732.1.22633
Domain Number 1 Region: 143-233,375-472,904-1114
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.88e-53
Family Calcium ATPase, transmembrane domain M 0.025
Further Details:      
 
Domain Number 2 Region: 467-490,669-775,829-897
Classification Level Classification E-value
Superfamily HAD-like 8.66e-30
Family Meta-cation ATPase, catalytic domain P 0.084
Further Details:      
 
Domain Number 3 Region: 484-500,539-730
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 4.14e-20
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0087
Further Details:      
 
Domain Number 4 Region: 237-299,333-371
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.88e-18
Family Calcium ATPase, transduction domain A 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001643732.1.22633
Sequence length 1126
Comment hypothetical protein Kpol_1009p21 [Vanderwaltozyma polyspora DSM 70294]; AA=GCF_000150035.1; RF=representative genome; TAX=436907; STAX=36033; NAME=Vanderwaltozyma polyspora DSM 70294; strain=DSM 70294; AL=Scaffold; RT=Major
Sequence
MDFPSSANTNTFDSQFDRALDNLHINNKSDNSNSNSNTWQEDNLYQENFEIQSLSKRMSN
NLDSHPLLNEGTTNYVPVDNNGYIAMNQSSSYSKLFNRILKFVQSRTNVRLTKYRSISDA
EVDRVQDYSEREIHPDTTPIYDRNKYPSNEISNAKYNAFNFLPILLYEQFKFFFNLYFLL
VALSQIIPALRIGYLSSYIVPLAFVLTVTMLKEAMDDIRRRKRDKEANNELYQVLAKSSQ
LVPSKDLKVGDLVKLKKGERIPADLVLLQSSEPSGEAFIKTDQLDGETDWKLRVASHLTQ
NLTEDDLMNKISITTSAPEKSIDSFLGKVTYKGATSNPLNVDNTLWANTVLASTGTCVGC
VIYTGKDTRQAMNTTKPTVKTGLLELEINSISKILCISVFVLSIFIVICAGFKNNDWYID
IMRYLILFSTIIPVSLRVNLDLAKSVYAYQIEHDDTIKDTIVRTSTIPEDLGRIEYILTD
KTGTLTQNDMQLKKLNLGSVSYTSETLDIVSNYIETLVESSKSTTNPTSRSAARKDVSAR
VKDLVVTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRNSITLLHEH
SGVTLNYQILQVFPFNSDSKRMGIIIHDQQKDEYWFLQKGADTVMTKIVESTEWLEEETG
NMAREGLRTLVIGRKKLSNKVYQQFRKDYDHASLAMVKRDEKMANTITKYLEHDLELLGL
TGVEDKLQRNVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLINRGQYVHVITKVNK
PEGALSQLEYLKINRNSCLLIDGESLAMYLKYFKTEFFNVTVNLPTVIACRCTPQQKADI
ALLIREMTQKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCYLTELL
LWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSNFEPIALYKGWLMVGYATCYTMAP
VFSLTLDRDIDESLTKIYPELYKDLTEGKSLSYKTFFTWVTLSLFQGTVIQLFSQTFTSI
EPVDFEKMVSISFVCLVINELIMVALEIYTWHRAMVISEIVTFAFFILSIPFLGEYFDLK
YMIRPSYWFILIFILLFSILPVWVMKSIYRRLHPPSYAKVQQFSLV
Download sequence
Identical sequences A7TPE6
tr|A7TPE6|A7TPE6_VANPO 436907.A7TPE6 XP_001643732.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]