SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001645701.1.22633 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001645701.1.22633
Domain Number 1 Region: 56-168
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.08e-37
Family Frataxin-like 0.00000705
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001645701.1.22633
Sequence length 175
Comment hypothetical protein Kpol_1043p33 [Vanderwaltozyma polyspora DSM 70294]; AA=GCF_000150035.1; RF=representative genome; TAX=436907; STAX=36033; NAME=Vanderwaltozyma polyspora DSM 70294; strain=DSM 70294; AL=Scaffold; RT=Major
Sequence
MFKRCSLRVGSFLPRFLAVNTTRHLVTRQIMLQGTPKVSSRINIHKRFFADGSAGGYAIP
DEVTQLPIEKYHTLADTALDDLTDRLEEISEKFPEQIPDVELSQGVLTLVIPEFGTYVIN
KQPPNKQIWLASPISGPNRYDYYQGEWVSLRDNTKLLDVLRDELQRALPDTELTL
Download sequence
Identical sequences A7TIQ1
436907.A7TIQ1 XP_001645701.1.22633 tr|A7TIQ1|A7TIQ1_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]