SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001646841.1.22633 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001646841.1.22633
Domain Number 1 Region: 1535-1827
Classification Level Classification E-value
Superfamily BEACH domain 6.28e-119
Family BEACH domain 0.0000000354
Further Details:      
 
Domain Number 2 Region: 1362-1488
Classification Level Classification E-value
Superfamily PH domain-like 2.27e-22
Family PreBEACH PH-like domain 0.017
Further Details:      
 
Domain Number 3 Region: 1927-2149
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.26e-18
Family WD40-repeat 0.0044
Further Details:      
 
Domain Number 4 Region: 221-353
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000329
Family Clostridium neurotoxins, the second last domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001646841.1.22633
Sequence length 2153
Comment hypothetical protein Kpol_2002p54 [Vanderwaltozyma polyspora DSM 70294]; AA=GCF_000150035.1; RF=representative genome; TAX=436907; STAX=36033; NAME=Vanderwaltozyma polyspora DSM 70294; strain=DSM 70294; AL=Scaffold; RT=Major
Sequence
MVTDSMEIGGFLSSIINIDQIGQDDEEDHQQKELNIIWNDLIENFETKIVKTSELIKDIE
SYVDWELTTTFSLSNIDDNFIINDSNIQQWLEFIVKGDEKFNSLQYSIALQIIISLSNIS
LFNKQKFASWAKSLKESLLDTLLENDKDLTILTLWKKILLVIYSIDCTPTDLLNLYKNFE
ENHFIPEILNELAKQSHDQLSQSYLQFENYYKSYKLKSLKTKIENDLTFQIYLELNDITS
NRIMTIGRSLFLEVTDGQLCLSNDEYIIGMFQNFEFKPLVFYCITLTVNSNDIALFVNGQ
YVNTVSLFENFILSLSVIELGSMICSFRLYRFQLLNAVLSELEVKVLYHVGSNYKITKEN
TGHEILGIRRAFGDSFLQQIFQSITAREIISLTEGISKIRNLKSDALLIDFNPYIELNSV
DHNNFLFLENKEHDSIENSTILIKGNVYYYKSSTLSDIFETFNSFRFVLSKLEVCDDYNK
LYEYVFHMVQLWSNYQLRVWFESKFGYQLLSHILTNKVIYKHKKALPIQFLNLFLEYSGW
ELSDITKSIIKDQRSYENLVLNINLWYLDVEDNEQLPSEIEIIRFLFFQISNLLETSKYK
RFNSRVLMRSNIIQKFCNYQHYLTVNMISNDIVSELNYDLVNVYVTLLKNDFTKQNVQWL
FNYSYYELKCGNYSNCNVLLTAIDTLILETLDNNRMDTLQVFNESLSIKFLLMAIDEIVT
VKKSPLILLNILLKIFSINTNGYQKFLDNSGMNLLLDILKGANVADYEEIVYMLYKYSLG
EFDYTTGSIQCENFDKIELLNENIVINKYLLNLSVCLLEWSVINDIRSGFQIDLNTFIIS
FMNKLSVMSSNKKNSSVFDTRKNKLLTCLLDLLVTLTKHQNGSIYLESALIIKQFLADNI
IYQAKYLNTNEFGKYINSITESDDSSNSFIIFSEDQYIYIQFLFVKEILPVITSDLSGLK
TELAFKFRSYPYMVSNLLSIYNYSMDKFATVELPLSFYLSTFSVLMESIKAIEISDHDII
KNVSKANLLNIFNLITLRLVHLLFVENFRFDEKSTQDLLNAIVKNAHILFKSNNSVFDKD
MTWILMLFLISESSCSTSGEAMLACLRNILIYNKSNQKYISEVMNIQGKIELSSLIESLE
TSNSNETLALIEKSKRHIVNLDQRDKLINYITKRLENGMSIGKFNSFDEISIEELKQLRM
DRDDSKIEKIHGLFRNDNYEISNKVYKLGNKQFSNFITDIEEENLIFDNEYEYLTFQNNQ
ILSLQLNQNISLEWTVQPVEDFERSRRKLLPSQLRKCIGESSIKDDSSVPDEQLNNSKKG
IGASSMLSYDLMSDLDLSGLSDADNSDENRKVLKLLKENDLIKKIWNCSRIVGLDIKEGV
LILGENYLYFVDNYYFSKDGKKVVNLSDVPLHLRDTNMTLIGGDISKSRFSNVEHKVFNW
DLTQITHVTKRPFLLRDIAMEVLFSRGSNFLFSFNTKSIRENVYLQLSKVSNNSNIDPLL
DCTLVELNSRSHGISLMNGISKASLKTKFLNALSSSSNFDEYEATKLWQNGEISNFCYLM
ILNTLAGRTFNDLTQYPVFPWIIADQESEFLDLANPKTFRDLSKPMGGQTTKRAEQFKER
YESLCQFDEQPTPPFHYGTHYSSAMIVSSYLIRLKPFVDSFLLLQDGRFGHADRLFSSIP
RAWKSSAVESTTDVRELIPEFFFLPEFLINTNHYDFGKDQNGNTVSNVKLPLWANGDPLI
YIAKNREALETEYVSEHLHEWIDLIFGYKQKGEKSVDSLNVFNNLSYPGAVDLENINDEN
ERRAITAIIHNFGQTPLQLFSEPHPRRNVLKYQSIKNCIKNICDDPYCIELEQLSKKSID
LIFFTDNTTYKADSSNDAVNLKCNLVINSRQFFEIEFEKFGIEVRKLKRLIKFDNTIVIS
VEFGEANIMVTGDKNGMIKIWKIKSKELNNSSTFEYDSLGSMHGHLFGIKEMKIYNEYQV
LVSLDYSGVVYLWDLSNFQIIRKLADHVSQIAVSQVDGNIITVNEDNNVAIYNLNGMLYC
ERLFKGSKITSIAFFDFSSISLGNLRHAYWKEKEAFAIGYNDGSIDMFILELSSLSQWDV
LLVKSLKSKNQDPITSLKFQLNDLKLKREVGNEINIQLFAGDNRGKLYKWGSK
Download sequence
Identical sequences A7TFG9
XP_001646841.1.22633 tr|A7TFG9|A7TFG9_VANPO 436907.A7TFG9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]