SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001647108.1.22633 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001647108.1.22633
Domain Number 1 Region: 9-152
Classification Level Classification E-value
Superfamily RPB6/omega subunit-like 6.28e-47
Family RPB6 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001647108.1.22633
Sequence length 153
Comment hypothetical protein Kpol_1050p110 [Vanderwaltozyma polyspora DSM 70294]; AA=GCF_000150035.1; RF=representative genome; TAX=436907; STAX=36033; NAME=Vanderwaltozyma polyspora DSM 70294; strain=DSM 70294; AL=Scaffold; RT=Major
Sequence
MSDYEEAFNEGNEHFEDFEVEHFSDEENFEEGFRDGETKNEEGKTIITGGLGPDDNQQND
IFRRKTLKERAIPKNDRTTTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAM
KELAEKKIPLVIRRYLPDGSFEDWSVEELVVDL
Download sequence
Identical sequences A7TF04
436907.A7TF04 XP_001647108.1.22633 tr|A7TF04|A7TF04_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]