SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001662085.1.48696 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_001662085.1.48696
Domain Number - Region: 88-153
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00968
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001662085.1.48696
Sequence length 247
Comment uncharacterized protein LOC5575603 [Aedes aegypti]; AA=GCF_002204515.2; RF=na; TAX=7159; STAX=7159; NAME=Aedes aegypti; strain=LVP_AGWG; AL=Chromosome; RT=Major
Sequence
MMKLVILGLLACSQVVLSNPIGEPSAAQPQDLDELAVLTEFDRLFNQLHYDIDYKLRIYR
MNHSRDLKNLNAQFISRYGFVITDIQHKKQQVKDAILEHALDIGDTQNPCIVEKNDEAIR
RATQAARDLSVAAEKIYGDMATITRVYFYPIVKDFQQTSSEFQWAVLEVLSRDNAVTGLQ
LALADLSFKYMANANMVNRVVDNLDYELEGFQDIINSLRRGAFKEIDDIGRNYVFNMEQL
LTDALTC
Download sequence
Identical sequences Q16NL8
XP_001662085.1.48696 7159.AAEL011936-PA AAEL011936-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]