SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001738468.1.18373 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001738468.1.18373
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.57e-25
Family ADP-ribosylglycohydrolase 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001738468.1.18373
Sequence length 193
Comment hypothetical protein [Entamoeba dispar SAW760]; AA=GCF_000209125.1; RF=representative genome; TAX=370354; STAX=46681; NAME=Entamoeba dispar SAW760; strain=SAW760; AL=Scaffold; RT=Major
Sequence
MRTSVLAIPYFWDEEKVKENSKKIGSTTHADPRCQASVNVIVLILAKLLQGREDIEEIIK
ESIYDSEKMLNEEYKKEFIEYTNAKTLEEIKLNESIGYTFKPVGCAILSLREAFKMKEKG
IDKTIIFEKLIERIAYEGGDADTNGAVVGAVLGTYLKGICMPNDWLDLDNKKWLEERLNR
LLHLYQLEPFHFK
Download sequence
Identical sequences B0EJU1
XP_001738468.1.18373 gi|165898304|gb|EDR25209.1| gi|167388192|ref|XP_001738468.1| jCVI|EDI_098010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]