SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001754147.1.60028 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_001754147.1.60028
Domain Number - Region: 281-320
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0112
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001754147.1.60028
Sequence length 451
Comment predicted protein [Physcomitrella patens]; AA=GCF_000002425.3; RF=representative genome; TAX=3218; STAX=3218; NAME=Physcomitrella patens; ecotype=Gransden 2004; AL=Scaffold; RT=Major
Sequence
MQSNYGKIQAVLFSVPFQGPLFLVKGSLKGFLEGVSGGESSKGQGMHMDPSNASMFQAFS
LSMQQQQSNDRKEALATKALQAMVNKIDQFDGRNISRYLRCYVREMELNWVSEKKMVELF
GLATIPEIRDHITSITDHYGNSWEVFSHALKDEYFLEDADRVTKKLYLEWIERPNKNLQA
TELLREFERQYTQLLKKNVEDAVGLLTKKEKRKDRSNIQKTVQVPKAPVRTTPPTMPTVH
PSTSLSKKADMEMEEIIRGMRDLQIKLARLEENTSTKNSKNVSKQGYVQRCIWCDDASHT
RKDCNEFNNMIRQGIICWKDGKIALKNREDLLQTNFGKGGMRALVQDYLKEHETAARESA
SYGARVDDEIGGSTETSEFWASSISTMQEGKLPREALLRTAATIRGRTGWEDPVESLSVH
AEILMILEKEILLRGKLEETRLGRQLHKNCL
Download sequence
Identical sequences A9RIV9
XP_001754147.1.60028 jgi|Phypa1_1|66722|fgenesh1_pg.scaffold_12000007 3218.JGI66722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]