SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001755150.1.60028 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_001755150.1.60028
Domain Number - Region: 89-206
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0222
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0098
Further Details:      
 
Domain Number - Region: 277-315
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0523
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 34-97
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0824
Family Insect pheromone/odorant-binding proteins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001755150.1.60028
Sequence length 905
Comment predicted protein [Physcomitrella patens]; AA=GCF_000002425.3; RF=representative genome; TAX=3218; STAX=3218; NAME=Physcomitrella patens; ecotype=Gransden 2004; AL=Scaffold; RT=Major
Sequence
MDPSISSMFKAFSLSMQQQQSNDRKKALTTKALQAVVNKIDQFDGRNISRYLRCYVHEME
LNRISEKKMVELFELATIPEIRDHITSITDRCGNSWEDFSHALKDEYFVEDADRVTKRLF
LKWIEWPNKNLQATELLREFVRQYSQLSKVEKLTLEPNKVDLFLQAADGESQEKLEPLLE
DKEEDEGLTTKWKNVEDAVELLTKKERRKDRSNIQKSVQAPKAPVHTIPPTMPTIQPSTF
LSKKADMEMEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDC
NEFNNMIRQGIICWKDGKIALKDREDLLQTNFGKGGMRALVQDYLNEHETAIRESASYGA
RVDDEIGGSMETSEFWASAVSTMQEGKLPREALLRTAATIRVHAYIAKSQHEALMEEKRQ
GNFDDTREGNSSKRQTRGDKAREAASQELPVKDTLASLGEKTKETKDKGKSIAYKLLSHI
EAATNLKGVLEERKLNAKVEFTLKKVLGIAKKEFHNVIIDNIKRKRQLMSETGTIHAIDA
RIYKDEEEVDIGYKLPTNEKNGYNQEVRFEDSNNKEMRTLSHYTRKHWARATTEVLVKVG
DTKEPIVALVDHGFEINLMSKDLYKKQKWPIDMEHRWAIRAANNTRGELYGACPDVKFRI
GDVAMEQHFFVQDTKLIQTKVLDDGSAYARVRSEDGRKAVQFLTVPPNHERNRDRLREKP
LPKIVEGFKDFGELGSLQDDERILGVYEENGLEDSLELITSIGLGDNDKIVEIHSRKVYT
ILESFQAPEVTVETRNKTVDKKIKSVARPLPEDSKEQIEEASKEASLRDPMSIGHQFTRE
TFEELKIGSDGSLLPEEITCFKKMLAKQESNGAFQYASADCNGVTEPDHSVFVLELVDAP
NIRGN
Download sequence
Identical sequences jgi|Phypa1_1|67823|fgenesh1_pg.scaffold_16000054 3218.JGI67823 XP_001755150.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]