SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001759567.1.60028 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_001759567.1.60028
Domain Number - Region: 269-312
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00172
Family Retrovirus zinc finger-like domains 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001759567.1.60028
Sequence length 316
Comment predicted protein [Physcomitrella patens]; AA=GCF_000002425.3; RF=representative genome; TAX=3218; STAX=3218; NAME=Physcomitrella patens; ecotype=Gransden 2004; AL=Scaffold; RT=Major
Sequence
MNGDYDYDNHRRNQQVKERQERFYFRNLLRQQQEGIQRKKRRWSWIKPWLHACVSIRAYP
SFERSTILHHYIPLEKLSRALVGDTASNEASESSSIIIRSLSTEELNNSDSLQERRVSKY
QIGTKRRIHINIARRPAQASMAEEAPAVPIAVQMGAIRDCTTSVVPLSTFNGWPGNQVPM
TNTMIGSYPRMIAPSMENLNSQGVVNATPLQAIPPVATYPSPMAYRQPEVPMNATINDSN
EALLLNLTKKMEELAVHMTKDKEKRHKPSNMRPNVWCNNYKGQGHFDTECPSPHQKMGQC
MYCGGKHNTANCWYLP
Download sequence
Identical sequences A9RZP7
3218.JGI72661 XP_001759567.1.60028 jgi|Phypa1_1|72661|fgenesh1_pg.scaffold_38000046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]