SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001760013.1.60028 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_001760013.1.60028
Domain Number - Region: 494-621
Classification Level Classification E-value
Superfamily YwmB-like 0.00994
Family YwmB-like 0.036
Further Details:      
 
Domain Number - Region: 332-370
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0186
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001760013.1.60028
Sequence length 658
Comment predicted protein [Physcomitrella patens]; AA=GCF_000002425.3; RF=representative genome; TAX=3218; STAX=3218; NAME=Physcomitrella patens; ecotype=Gransden 2004; AL=Scaffold; RT=Major
Sequence
MRASKLLRASYPIWDLNWSGDSMWSRLRGFDSVSGRPVLCAVSGNVVYGFLGEVSGGESS
KGQGMHMDPSIDSLFQAFSLSMQQQQSNDRKEALATKALQAVVNKIDQFDGRNISRYLRC
YIREMELNRVSEKKMVALFGLATIPEIRDHITSITHALKDEYFLKDADRVTKKLFLGWIE
RPNKNLQATELLREFERQYSQLSKVEKLTLEPNKVDLFLQAADGELQEKLEPLLEDKEED
EGLTTKWKNVEDAVGLLTKKERRKDRSNIPKTVQAPKAPVRTIPPTMPTVQPSTSLSRKA
DMGMEEIIRGMRDLQIKLARLEENISINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNN
MIRQGIICWKDGKIALKDREELLQINFGKGGMRALVQDYLKEHETVVRESASYGARVDDE
IGGSTETSEFWASAVSTMQEGKLPREALLRTAATIRGRTGWEDPVESLSVHAYIAKTQHE
ALMEEKRRGNFDDTREGNSFKRQTQGDKAREAASQELPVKDTSASLGEKTTETKDKGKSI
AYKLLSDIEAATNLKGVLEERILNAKVEFTLKEVLGIAKKEFHDVIIDSIKQKRQLMSET
GMSHAIDARICRDEEEVDIGYKQSTNEKNGYNQRQEDESDLDNEGDEDELDKDVGDIF
Download sequence
Identical sequences A9S156
3218.JGI73209 jgi|Phypa1_1|73209|fgenesh1_pg.scaffold_40000158 XP_001760013.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]