SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001777460.1.60028 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_001777460.1.60028
Domain Number - Region: 327-365
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0147
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 145-237
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0366
Family Arfaptin, Rac-binding fragment 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001777460.1.60028
Sequence length 617
Comment predicted protein [Physcomitrella patens]; AA=GCF_000002425.3; RF=representative genome; TAX=3218; STAX=3218; NAME=Physcomitrella patens; ecotype=Gransden 2004; AL=Scaffold; RT=Major
Sequence
MGEPGSKSQLDPISRHPIRGLLASMRPELVRRLNVVPIMGLRFRFRLFHPSWYSGNVLLV
KRSLKVRRPTRSPAGKHDLWEEFLIGVLLKDKQLQSNDRKEALATKALQEVVNKIDQFDG
RNISRYLRCYVREMELNRISEKKMVELFGLATIPKIRNHITSITDHYGNSWEVFSHALKD
EYFLEDVDRVTKKLFLEWIEWPNKNLQATELLRKFERQYSQLSKLELLLEDKEEDEGLTT
KWKNVEDAMGLLTKRERRKDRSNIPKTVQAPTAPVCTTPPTMPTVQPSTSLSKKADMEME
EIIRGMQDLQIKLARLEENTSINNLKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQG
VICWKDGKIALKDRDGLLQTNFGKGGMRALVQDYLKDHETAARESTSYGARIDDDLGGST
KTSEFWASAVSTIQEGKLPREALLRTAATIRGTTGWEDPVESLSVHAYIAKSQHEALMEE
KRQGNFDDTREGNSCKRQSRGNKAREAASQELPVKDTSASLEEKTRETKDKSKSIAYKLL
SDIEAATNLKAVLEERILNTKVEFTLKEVLEITKKKFHDVIIDNIKRKRQLMGETRMSHA
IDARIYKDEEEVDIGYK
Download sequence
Identical sequences A9TFQ9
3218.JGI92174 XP_001777460.1.60028 jgi|Phypa1_1|92174|fgenesh1_pg.scaffold_221000021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]