SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001778083.1.60028 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_001778083.1.60028
Domain Number - Region: 243-263
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0068
Family Retrovirus zinc finger-like domains 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001778083.1.60028
Sequence length 356
Comment predicted protein [Physcomitrella patens]; AA=GCF_000002425.3; RF=representative genome; TAX=3218; STAX=3218; NAME=Physcomitrella patens; ecotype=Gransden 2004; AL=Scaffold; RT=Major
Sequence
MIRAAAWVRPEVFHNPKLTIRKEHSLYYTRYSEENINEYNAKTAANGWYWLAAKNTINSP
NVPRDLLSSSRVNVFGSSLQMKRKISVVIVKVAEESSTPAKGCYGNKSGRCSSVGEHPTT
RAHLIDPEKTRAPFTDHHGIDCSSTGQTPAHPAPLSPRIGDNATQSTCNTDTLQFLGLSH
YLWHESCLKIIASRLGQVLFIEESSSYSHKTVGPHIKVLLHNINKTPKPTLDTPLLHKIL
ASGHPHLCTKCKGLGHTSIECKHRPLLQPPPYRGQRQQEHTKDNQETPSHAPRRHHSINH
ATTRGKDSQGTTLTELELFPPQRLPPQQELFPESPQQRLNKDFINQLENESRSHLV
Download sequence
Identical sequences A9THL9
3218.JGI92871 jgi|Phypa1_1|92871|fgenesh1_pg.scaffold_232000040 XP_001778083.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]