SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001780104.1.60028 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001780104.1.60028
Domain Number 1 Region: 198-287
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.21e-29
Family Canonical RBD 0.00011
Further Details:      
 
Weak hits

Sequence:  XP_001780104.1.60028
Domain Number - Region: 128-147
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0101
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001780104.1.60028
Sequence length 288
Comment predicted protein [Physcomitrella patens]; AA=GCF_000002425.3; RF=representative genome; TAX=3218; STAX=3218; NAME=Physcomitrella patens; ecotype=Gransden 2004; AL=Scaffold; RT=Major
Sequence
MGGRRNLRWGDAAEEDDEIEGVLPPTQVFGPDEKGVKIIIEWKKNDDNVRTKVIKTIRVK
KQMKKLNPATIRRRSLGKFGDALGQNASDNLTVVSTEEIFLERTRPAGAKAEPEKGADLA
SLGNASLIVCRTCGKKGDHWTSKCPFKELAASRGIIAGGEKPPTDDNVPGISAGAGGKGS
YVPPSMRYGKGNEGESMKRPGRDDNSIRVTNLSEDTREQDLQELFSPFGSISRIYVAFDR
ETGLSRGFAFINFVNRDDAIRAINKLDGYGYDNLILRVEWATPRADRS
Download sequence
Identical sequences A9TNB3
PP1S271_56V6.1 3218.JGI196691 jgi|Phypa1_1|196691|estExt_gwp_gw1.C_2710054 XP_001780104.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]