SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001786349.1.60028 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001786349.1.60028
Domain Number 1 Region: 105-142
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000178
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001786349.1.60028
Sequence length 183
Comment predicted protein [Physcomitrella patens]; AA=GCF_000002425.3; RF=representative genome; TAX=3218; STAX=3218; NAME=Physcomitrella patens; ecotype=Gransden 2004; AL=Scaffold; RT=Major
Sequence
MIPWQGGYQMTNWNDASESYPGRSDYGTIPQGIVNAVPLQAVLPSSSQPYVPYSAYQKLI
PTKELTNELVSRDPNESLLLTLTKKMDELVVNLAKDKEKRHKPTNMQPNVWCSNCKGQGH
LVTECSSPPQMMVQCTFCGDPNKPTGGGQRSCSTGLTSTSRRGGERSTYQGPTERQESNS
GPG
Download sequence
Identical sequences A9U664
jgi|Phypa1_1|103032|fgenesh1_pg.scaffold_1083000001 XP_001786349.1.60028 3218.JGI103032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]