SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001798010.1.30160 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001798010.1.30160
Domain Number 1 Region: 66-453
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.08e-93
Family AAT-like 0.000000577
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001798010.1.30160
Sequence length 458
Comment hypothetical protein SNOG_07678 [Parastagonospora nodorum SN15]; AA=GCF_000146915.1; RF=representative genome; TAX=321614; STAX=13684; NAME=Parastagonospora nodorum SN15; strain=SN15; AL=Scaffold; RT=Major
Sequence
MRSLATSASRHIRPVVFRAQCPTNLIPLRAMSATTRREDPFKPAARVAGQKQDVWSIVNE
AAAASPVQPIVNMGQGFFGYNPPKFVLDAAKSALDQVDCNQYSPTKGRPRLKKAIADAYS
PFFGRTLDPDKEVTITTGANEGMLSAFMGFLEQGDEVIVFEPFFDQYISNIEMPGGKVVY
VPLHPPKDGATKTTSASEWSLDLKELEAAITPKTRMIVLNSPHNPIGKVFSKEELQAIGD
ICVKHNIIILSDEVYDRLYYVPFTRVATLSPEIAKLTLTVGSGGKNFYATGWRVGWLIGP
EHLIKYVSAAHTRICYSSVSPLQEATAIGFEQADAHGFWDESKREMKAKMDKFTAIFKEL
DLPYSDPEGGYFVLVNMSKVKLPEDYDFPPHVAERPRDFKLSWFLIKEVGVAAIPPTEFF
TPGNAHIVEDWLRFAVCKNDDVLETAMERLRGLKKYIQ
Download sequence
Identical sequences Q0UKN6
SNOT_07678 XP_001798010.1.30160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]