SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001877560.1.58555 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_001877560.1.58555
Domain Number - Region: 31-60
Classification Level Classification E-value
Superfamily Ribosomal protein L1 0.00235
Family Ribosomal protein L1 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001877560.1.58555
Sequence length 61
Comment predicted protein [Laccaria bicolor S238N-H82]; AA=GCF_000143565.1; RF=representative genome; TAX=486041; STAX=29883; NAME=Laccaria bicolor S238N-H82; strain=S238N-H82; AL=Scaffold; RT=Major
Sequence
MSFFWNNSMTLTYHQVEQALSVKRAGLDTGAACQHNTENKHNFVETFELWIGLKNYDPKR
D
Download sequence
Identical sequences B0D1L9
29883.JGI314110 jgi|Lacbi1|314110|eu2.Lbscf0005g06990 XP_001877560.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]