SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001878043.1.58555 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001878043.1.58555
Domain Number 1 Region: 761-852
Classification Level Classification E-value
Superfamily Acid proteases 0.0000282
Family Pepsin-like 0.09
Further Details:      
 
Weak hits

Sequence:  XP_001878043.1.58555
Domain Number - Region: 576-614
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00055
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001878043.1.58555
Sequence length 1057
Comment predicted protein [Laccaria bicolor S238N-H82]; AA=GCF_000143565.1; RF=representative genome; TAX=486041; STAX=29883; NAME=Laccaria bicolor S238N-H82; strain=S238N-H82; AL=Scaffold; RT=Major
Sequence
MANNNEGTRKTGRKTNNSQSAGMAGGTSTTPGITSSTSQVVPPTNTLPEAENDEARPISE
SAPSGGQHVESFEGPADQEEDDIRSDYSLGLVEFGELTELGGPYRASDLPSDRSAYSEIT
IEFPSCKAFSSYGDMEKGLKKSEKVFSTAGRHLQALKFGETSLRRSISNYPGKNMSRNRK
KVFTEELGILNELLTNLYCFKDEERIGFALQRIILVSLNQRLRLRREQAEEDLIMAGYGI
PSIPRWGLTGKADEFWNANDFEILGACYRREVENFLTYLSDHHEFPDTRRAETSSKPRTT
PLGSPAVSLGERSPVLSASPVLAAPVFAPGEADSILRFQRPSTLSYTFRTPRNVNSSVFG
HPTQNTASKAFQELLGFKESKRGGQTRQVTVRSPSPTTPVRQTKGSHSGGAPGPGDSDGD
DSNDEGENRPSRNPRIPQQPHRNPFERQPPPGESTSVTQKTPTEPQFDVKLKMEAIPTWD
GSPDSLRRWFLKLNSLAKRSDIVFKQLDSGNGRELPIKFHEDSLVKSGNKPLPPVRNSYY
NKDTQPKSPFNPFRTQRANVNLVGWTRNTSKPQFPKDDSNVSPRGTPEEKGARPCRHCGS
PKHWDRDCKYARKGERFARVNSVTLQEDEKEAQDRRKFGPSGQVGFSRTLSVKDPSSLGG
EYHTSKIYHVGADWKTNLKNPYSTAPCLSSDFIIRRRPPEINRKTRRKLAREIQMTTLAT
QVQESNGDLIELRKHLARPPGCAFLGAKVTEAYASLNGLDTRPIPVIIDSGSDITLISQK
TLDQMLKAPKIRVGQQIKLIQVTGKAIITGYVILDLIFKTPKGPVQINVEAYVVKGMSAE
FILGNDFADQYSISVLREEGETTLKFGSSGRSVKVHNSLSTPFLDEDGHAFKKKRTRHRQ
AERQVRSRHQVTIPPEASKLVHVDAGLNDSTSTIFVERSFLSNGNAEELYGIADTLVDRD
DSRVFVSNFSKNPITIPAGQVLGTAKNPSSWLDKKDCYSSTQKQDAERRVHLIQTLLQNQ
TTTFKVTTPTNTSMHTGRSQGVQLTTWSGCGLMHSLL
Download sequence
Identical sequences B0D2G3
jgi|Lacbi1|324609|fgenesh3_pg.C_scaffold_6000103 XP_001878043.1.58555 29883.JGI324609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]